KEGG   Pseudomonas putida KT2440: PP_0261Help
Entry
PP_0261           CDS       T00114                                 

Gene name
cysQ
Definition
(RefSeq) 3'(2'),5'-bisphosphate nucleotidase CysQ
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00920  Sulfur metabolism
ppu01100  Metabolic pathways
ppu01120  Microbial metabolism in diverse environments
ppu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PP_0261 (cysQ)
Enzymes [BR:ppu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PP_0261 (cysQ)
Transfer RNA biogenesis [BR:ppu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PP_0261 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P DUF2593
Motif
Other DBs
NCBI-GeneID: 1043847
NCBI-ProteinID: NP_742428
UniProt: Q88R73
Position
315186..315986
Genome map
AA seq 266 aa AA seqDB search
MHEVVKLALTAGEAILPFWRADVAVTNKADDSPVTAADLAAHRVIADGLLALAPQIPVLS
EEDCNIALAERQNWSRWWLVDPLDGTKEFIAGSEEFTVNIALIENGEVVFGVVSMPTNGR
CYFGGRGMGAWRADAGEAAQLIQVRNAPAQGERFTVVASRRHSSPEQEALLAGLGAAVGE
LELANIGSSLKFCLLAEGSADCYPRLAPTSQWDTAAAQGVVEGAGGEVIGLDGLPFRYPP
RESLLNPYFLALPVNAEWRQAFLNLI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaagtggtcaagctggcgctgacggcaggcgaggcgatcctgccattctggcgc
gccgatgtcgcggtaaccaacaaggccgacgattcgccggttaccgccgccgacctagcc
gcgcaccgggtaatcgccgatggtctgctggcgctggcgccgcagattccggtgctgtcc
gaagaggactgcaatattgcgctggccgagcggcaaaactggagccgctggtggctggtc
gatccgctggatggcaccaaggaattcattgccggcagtgaagagttcacggtcaacatc
gccctgatcgagaacggcgaggtggtgtttggcgtggtgtcgatgcccaccaatgggcgc
tgctattttggtggacgcggcatgggggcctggcgtgcagatgccggtgaggcagcccag
ctgatccaagtacgcaacgcacccgcgcagggcgagcgttttaccgtggtggccagccgt
cggcattccagcccggagcaggaagcgctgttggccggccttggggctgcggtgggcgag
ctggagctggccaatatcggcagctcgttgaagttctgcctgttggccgagggcagcgcc
gattgttatccgcgcctggcgccgacttcgcagtgggatactgctgcggcgcagggtgtg
gtggagggggccggtggcgaagtgatcgggctggatggcttgccgttccggtatccgccg
cgcgagtcgctgcttaacccgtacttcctggcgttgccggtaaatgctgaatggcgccag
gccttcctgaacctcatctaa

DBGET integrated database retrieval system