KEGG   Pseudomonas putida KT2440: PP_0552Help
Entry
PP_0552           CDS       T00114                                 

Gene name
bdhA
Definition
(RefSeq) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PP_0552 (bdhA)
Enzymes [BR:ppu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PP_0552 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PP_0552 (bdhA)
    1.1.1.-  
     PP_0552 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 DAO PALP UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 1044336
NCBI-ProteinID: NP_742715
UniProt: Q88QE2
Position
complement(640763..641851)
Genome map
AA seq 362 aa AA seqDB search
MNDLSHTHMRAAVWHGRHDIRVEQVPLPADPAPGWVQIKVDWCGICGSDLHEYVAGPVFI
PVEAPHPLTGIQGQCILGHEFCGHIAKLGEGVEGYAVGDPVAADACQHCGTCYYCTHGLY
NICERLAFTGLMNNGAFAELVNVPANLLYRLPQGFPAEAGALIEPLAVGMHAVKKAGSLL
GQTVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSSARKAKAKEAGANVVLDPSQCDALAE
IRALTAGLGADVSFECIGNKHTAKLAIDTIRKAGKCVLVGIFEEPSEFNFFELVSTEKQV
LGALAYNGEFADVIAFIADGRLDIRPLVTGRIGLEQIVELGFEELVNNKEENVKIIVSPG
VR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacctgagccacacccacatgcgcgcggccgtctggcatggccgccacgatatt
cgtgtcgaacaggtacctttgccggccgaccctgcgccgggctgggtgcagatcaaggtg
gactggtgcggcatctgcggctccgacctgcacgaatatgttgccggcccggtgttcatc
ccggtagaggccccgcacccgctgaccggcattcagggccagtgcatcctcggccacgaa
ttctgcggccacatcgccaagcttggcgaaggcgtggaaggctatgccgtaggcgacccg
gtggcggcagacgcgtgccagcattgtggtacctgctattactgcacccatggcctgtac
aacatctgcgaacgcctggcgttcaccggcctgatgaacaacggtgccttcgccgagctg
gtcaacgtgcccgccaacctgctctaccggctgccgcagggcttccctgccgaagccggg
gcactgatcgagccgctggcggtgggtatgcacgcggtgaaaaaggccggcagcctgctt
gggcaaaccgttgtagtggttggggccggcaccatcggcctgtgcaccatcatgtgcgcc
aaggctgcaggtgcggcacaggtcatcgcccttgagatgtcctctgcgcgcaaagccaag
gccaaggaagcgggcgccaacgtggtgctggaccccagccagtgcgatgccctggcggaa
atccgcgcactgactgctgggctgggcgccgatgtgagttttgagtgcatcggcaacaaa
catacggccaagctggccatcgacaccatccgcaaagcaggcaagtgcgtgctggtgggt
attttcgaagagcccagcgagttcaacttcttcgagctggtgtccaccgagaagcaagtg
ctgggggcgttggcgtacaacggcgagtttgctgacgtgattgccttcattgctgatggt
cggctggatattcgcccgctggtaaccggccggatcggattggagcagattgtcgagctg
ggcttcgaggaactggtgaacaacaaagaggagaacgtgaagatcatcgtttcaccaggt
gtgcgctga

DBGET integrated database retrieval system