KEGG   Pseudomonas putida KT2440: PP_0582Help
Entry
PP_0582           CDS       T00114                                 

Definition
(RefSeq) thiolase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00071  Fatty acid degradation
ppu00072  Synthesis and degradation of ketone bodies
ppu00280  Valine, leucine and isoleucine degradation
ppu00310  Lysine degradation
ppu00362  Benzoate degradation
ppu00380  Tryptophan metabolism
ppu00620  Pyruvate metabolism
ppu00630  Glyoxylate and dicarboxylate metabolism
ppu00640  Propanoate metabolism
ppu00650  Butanoate metabolism
ppu00900  Terpenoid backbone biosynthesis
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01120  Microbial metabolism in diverse environments
ppu01130  Biosynthesis of antibiotics
ppu01200  Carbon metabolism
ppu01212  Fatty acid metabolism
ppu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP_0582
   00630 Glyoxylate and dicarboxylate metabolism
    PP_0582
   00640 Propanoate metabolism
    PP_0582
   00650 Butanoate metabolism
    PP_0582
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PP_0582
   00072 Synthesis and degradation of ketone bodies
    PP_0582
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PP_0582
   00310 Lysine degradation
    PP_0582
   00380 Tryptophan metabolism
    PP_0582
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PP_0582
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PP_0582
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PP_0582
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppu04147]
    PP_0582
Enzymes [BR:ppu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PP_0582
Exosome [BR:ppu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PP_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 1044385
NCBI-ProteinID: NP_742745
UniProt: Q88QB2
Position
679114..680391
Genome map
AA seq 425 aa AA seqDB search
MRSTRRVAILGGNRIPFARSNGAYATASNQAMLTAALEGLIERYRLHGLRLGEVVAGAVL
KHSRDMNLTRECVLGSRLSPQTPAYDIQQACGTGLEAALLVANKIALGQIDCGIAGGVDS
TSDAPIAVNEGLRHILLQANRGKSLGERLKPFLKLRPHHLKPELPRNSEPRTGLSMGEHC
ERMAHTWRVGRAEQDELALLSHQKLAAAYAEGWQDDLLTPFLSLARDNNLRPDLSLEQLA
RLKPAFDRSGQGTLTAGNSTPLTDGASLVLLGSEAWAQQQGLQVLAYLVDGETAAVDFVT
GREGLLMAPVYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLKAWEDADYCRERLGLE
APLGAIDRSKLNVRGSSLAAGHPFAATGGRILANLAKLLATAGKGRGLISICAAGGQGVT
VIVER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcaactcgccgggtcgcaatcctgggcggcaaccggatccctttcgcccgctcc
aatggcgcctacgctacggccagcaaccaggcgatgctcacggccgcgcttgaaggcttg
atcgaacgctatcgcctgcacgggctgcggttgggcgaggtggtggccggtgccgtgctc
aagcactcgcgcgacatgaacctgacccgcgagtgcgtcttgggttcgcgcctgtcaccg
cagaccccggcctatgacatccagcaggcctgcggtaccgggctggaggctgcgctgctg
gtagccaacaagattgccctggggcagatcgactgcggtattgcaggcggtgtcgatagc
acctccgatgcgccgatcgccgtcaacgaaggcttgcgccatatattgctgcaggccaac
cgtggcaaaagccttggcgaacggttaaagcccttcctcaagctgcggcctcatcacctg
aaacccgagctgccacgcaatagcgagccgcgtacggggttgtcgatgggcgagcattgc
gagcgcatggcccacacctggcgcgttggccgcgccgagcaggacgaattggcgctgctt
agccaccagaagctggccgctgcctatgccgagggttggcaggacgacctgttgacgccg
tttctttcgctggcacgggacaacaacctgcgccccgacctgagtcttgaacagttggcc
agactcaaaccagcctttgaccgcagcgggcagggcacgttgacggcgggtaattccacg
ccgttgaccgatggtgcttcgctggtgctgttgggcagcgaggcgtgggcgcagcagcag
gggttgcaggtgcttgcctatctggtcgatggcgaaaccgctgcggtggattttgtcacg
gggcgcgaagggttgttgatggcgccggtgtatgccgtgccgcgcttgctggcacgcaat
ggcctgacgctgcaggactttgactactacgaaatccacgaagcctttgcggcccaggtg
ctgtgcacgctcaaggcctgggaagatgccgattactgccgtgaacggttgggcctggag
gcgccgcttggcgcgatcgaccgcagcaaactcaatgtcaggggcagttcgctggcggcc
gggcacccgtttgcggcaaccggtgggcggatattggccaacctggccaagctgttggca
acggcgggtaaggggcgcgggctgatttcgatctgtgcggcaggcgggcagggggtgacc
gttatcgtcgagcgctga

DBGET integrated database retrieval system