KEGG   Pseudomonas putida KT2440: PP_0613Help
Entry
PP_0613           CDS       T00114                                 

Definition
(RefSeq) amidase family protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00970  Aminoacyl-tRNA biosynthesis
ppu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PP_0613
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ppu03029]
    PP_0613
Enzymes [BR:ppu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PP_0613
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PP_0613
Mitochondrial biogenesis [BR:ppu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PP_0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 1044430
NCBI-ProteinID: NP_742775
UniProt: Q88Q82
Position
complement(718507..719916)
Genome map
AA seq 469 aa AA seqDB search
MTQKTAIGELTAVELLELYHRRQLSPVEVVDDVLARIDLHNPAVNAFCHVDGEGARAAAR
ASEQRWQRGQPCGRLDGVPASIKDLTLTRGMPTRKGSRTTSGAGPWEIDAPFSAFMREAG
AVLVGKTTTPEFGWKGVTDNPLYGITRNPWDTRLTAGGSSGGAAAAAALNLGVLHQGSDA
GGSIRIPCAFTGTFGIKPTFGYVPQWPASAMTVLSHLGPMTRTVDDSVLMLDCVARPDAR
DGLAGAPRQAPWLSQQQDLSGLRIAYSANFGYVQVDPQIQALVAQAVQRLARLGAQVEEV
DPGFSDPLETFNTLWFAGAARLASALSDEQKALLDPGLRWIAEQGAQISLGEYTQALEAR
AELIAKMNAFHQRYDVLVSPMLPLVAFEAGHNVPPGSGMAQWMEWTPLSYPFNLTQQPAA
SVPCGFTREGLPVGLQVVAGRFADEQVLRVCKVYEQHYPSRHLQAPITG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaaaaccgcgattggcgaactcaccgccgtcgaactgctcgaactgtaccat
cgccgccagttgtcacccgtcgaggtggtcgacgatgtgctggcgcgtatcgacctgcat
aacccggcggtcaacgccttctgccatgtcgacggcgaaggcgcccgcgccgccgcccgt
gccagcgaacagcgctggcaacgtggccaaccctgtggccgactggatggcgtacccgcc
tcgatcaaggacctgaccctgacccgcggcatgcctacccgcaagggctcgcgtactacc
tcgggtgccgggccgtgggaaatcgatgcgcccttcagcgccttcatgcgtgaagccggt
gcagtgctggtgggcaagaccaccacgccagagttcggctggaaaggggtgaccgacaac
ccgctgtacggcatcactcgcaacccgtgggacaccaggctgactgccggtggttcgtct
ggtggtgctgcggcagccgccgcgctgaacctgggggtgctgcatcagggcagcgatgcc
ggtggttcgattcgcatcccttgcgccttcaccggcaccttcggcatcaaaccgaccttc
ggctatgtgccgcaatggccggccagcgccatgaccgtgctgtcgcacctggggccgatg
acgcgtaccgtggacgactcggtgctgatgctcgactgcgtagcgcgccccgatgcccgc
gacggtttggccggcgcaccccggcaggcgccgtggctcagccagcagcaagatctgagc
ggcctacgcatcgcctacagcgccaacttcggttacgtgcaggtcgacccacagatccag
gcactggtggcgcaagcggtgcagcgcctggcgcggctgggtgcgcaggtagaggaagtg
gacccgggcttcagcgacccgctggaaaccttcaacaccctgtggtttgccggcgcggcg
cggttggccagtgccttgagcgatgagcagaaagcgttgcttgacccggggctgcgctgg
attgccgaacaaggtgcacagatcagccttggcgaatacacccaggcgcttgaggcacgg
gcagaattgattgcgaagatgaatgcctttcatcagcgatatgacgtgctggtatcgccg
atgctgccgttggtggcgttcgaagccggacacaacgtgccgcctgggtcggggatggcg
caatggatggagtggacgccgttaagctatccgttcaacctgacccaacagccggcggcc
tcggtaccctgcgggttcacccgcgaggggttgccggtgggcctgcaggtggtggccggg
cgctttgctgatgagcaagtgctgcgggtgtgcaaggtgtatgagcagcattatccgagc
cggcacctgcaagcaccgattactggctga

DBGET integrated database retrieval system