KEGG   Pseudomonas putida KT2440: PP_0623Help
Entry
PP_0623           CDS       T00114                                 

Gene name
rluD
Definition
(RefSeq) 23S rRNA pseudouridine(1911/1915/1917) synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
ppu  Pseudomonas putida KT2440
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppu03009]
    PP_0623 (rluD)
Enzymes [BR:ppu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     PP_0623 (rluD)
Ribosome biogenesis [BR:ppu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PP_0623 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 TruB_N
Motif
Other DBs
NCBI-GeneID: 1044441
NCBI-ProteinID: YP_009236917
UniProt: A0A140FVZ6
Position
728512..729474
Genome map
AA seq 320 aa AA seqDB search
MSEIIQLSAEVPSELGGQRLDQVAAQLFAEYSRSRLTSWIKEGRLTVDGAVVRPRDLVHG
GSQLALEAEQEAQGEWIAEDIELDIVYEDDHILVINKPAGLVVHPAAGHASGTLLNALLH
HVPDIVNVPRAGIVHRLDKDTTGLMVVAKTLQAQTKLVEQMQARKVSRIYECIVIGVVTA
GGKIDAPIGRHGGMRQRMAVTDGGKPAVSHYRVLKRFRSHTHVRVKLETGRTHQIRVHMA
HVGFPLVGDQTYGGRFRIPPAASPTMVEAVKTFPRQALHARFLALAHPITGEVMKWESPL
PDDFVWLLSLLNQDRESFIG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagatcattcaacttagcgcagaggtaccgtccgaactgggcggccaacgcctc
gaccaggtcgccgcccaattgttcgccgagtactcgcgttcgcggctaacttcgtggatc
aaagagggccgcctgacggtcgatggtgcagtcgtgcgccctcgagaccttgttcatggt
ggctctcagcttgccctggaggccgaacaagaggcccagggcgagtggatcgcagaagat
atcgaactggatatcgtctacgaagacgaccacatcctggtgatcaacaagcctgccggg
ctggttgtgcacccggcggccgggcatgccagcggcaccctgctcaacgcgctgctgcac
catgtgccagacatcgtcaacgtgccgcgcgccggtatcgtgcaccgcctggacaaggac
accaccggcctgatggtggtggccaagaccctgcaggcgcagaccaagctggtcgagcag
atgcaggcccgcaaggtcagccgcatctacgagtgcatcgtgattggcgtggtgactgcc
ggtggcaagatcgacgcgcccatcggccgccacggcggcatgcgccagcgcatggctgta
accgacggcggcaagccggcggtcagtcactaccgcgtactcaagcgcttccgctcgcac
acccatgtgcgggtcaagctggaaaccggccgtacccaccagattcgcgtgcacatggcc
cacgtgggtttcccactggttggtgaccagacgtacggcgggcgctttcgtattccgccc
gctgccagcccgaccatggtcgaggcggtcaagaccttcccgcgccaggcgctgcatgcg
cgtttcctcgccttggcccacccgattaccggtgaagtcatgaagtgggaatcgccactg
ccggatgacttcgtctggttgctgtcgctgctgaaccaggaccgcgagagcttcatcgga
tga

DBGET integrated database retrieval system