KEGG   Pseudomonas putida KT2440: PP_1017
Entry
PP_1017           CDS       T00114                                 
Symbol
gtsC
Name
(GenBank) mannose/glucose ABC transporter, permease protein
  KO
K17317  glucose/mannose transport system permease protein
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PP_1017 (gtsC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppu02000]
    PP_1017 (gtsC)
Transporters [BR:ppu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Glucose/mannose transporter
    PP_1017 (gtsC)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AAN66642
UniProt: Q88P36
Position
1160189..1161034
AA seq 281 aa
MHSPVDKPVLSLSRMAIHAVLLIAVLLYLVPLVVMLLTSFKTPEDITTGNLLSWPAVITG
IGWVKAWGAVSGYFWNSIMITVPAVLISTAIGALNGYVLSMWRFRGSQLFFGLLLFGCFL
PFQTVLLPASFTLGKLGLASTTGGLVLVHVVYGLAFTTLFFRNFYVSIPDALVKAARLDG
AGFFTIFRRIILPMSTPIIMVCLIWQFTQIWNDFLFGVVFSSGDSQPITVALNNLVNTST
GAKEYNVDMAAAMIAGLPTLLVYVVAGKYFVRGLTAGAVKG
NT seq 846 nt   +upstreamnt  +downstreamnt
atgcatagtcctgtcgacaagccagtgctcagcctcagccgcatggccatccatgccgtg
ttgctgatcgccgtgctgctgtatctggtgccgctggtggtgatgctgctgaccagcttc
aagacccccgaagacatcaccaccggcaacctgctgagctggcctgcagtgattaccggc
ataggctgggtcaaggcctggggagcggtcagcggttacttctggaactcgatcatgatc
accgtgcccgcggtgctgatctccaccgcgattggtgcactgaacggctatgtgctgtcg
atgtggcgcttccgaggttcgcaactgttcttcggcctgctgctgttcggctgtttcctg
ccgttccagaccgtgctgctgccggcctcgttcaccctcggcaagcttggcctggccagt
accactggtggcctggtgctggtgcatgtggtctacggcctggccttcaccacgctgttc
ttccgcaacttctacgtgagcatccccgacgcgctggtcaaggccgcgcggttggacggt
gccgggttcttcaccatcttccgccgcatcatcctgccgatgtccacgccgatcatcatg
gtctgcctgatctggcagttcacccagatctggaacgacttcctgttcggcgtggtgttc
tccagcggcgattcgcaaccgatcaccgtagccctgaacaatctggtcaataccagcacc
ggggccaaggaatacaacgtcgacatggcggcagcgatgatcgctggcctgccaaccctg
ctggtctacgtggtggcaggcaaatatttcgtgcgcgggctgacggccggcgcggtcaag
gggtaa

DBGET integrated database retrieval system