KEGG   Pseudomonas putida KT2440: PP_1068
Entry
PP_1068           CDS       T00114                                 

Gene name
gltL
Definition
(RefSeq) glutamate/aspartate ABC transporter ATP binding protein
  KO
K10004  glutamate/aspartate transport system ATP-binding protein [EC:7.4.2.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu02010  ABC transporters
ppu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PP_1068 (gltL)
  09132 Signal transduction
   02020 Two-component system
    PP_1068 (gltL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppu02000]
    PP_1068 (gltL)
Enzymes [BR:ppu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     PP_1068 (gltL)
Transporters [BR:ppu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter
    PP_1068 (gltL)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 Rad17 AAA_16 RsgA_GTPase AAA_23 AAA_22 AAA_33 AAA_15 ATPase_2 AAA_18 SbcCD_C AAA_30 Mg_chelatase AAA_24 AAA_28 AAA DLIC RNA12 AAA_25 Zeta_toxin
Other DBs
NCBI-GeneID: 1044717
NCBI-ProteinID: NP_743229
UniProt: Q88NY5
Position
complement(1223275..1224045)
AA seq 256 aa
MAGQAPAKKDLRMISIKNVNKWYGDFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKCVN
ALEPFQKGDIVVDGTSIADPKTNLPKLRSRVGMVFQHFELFPHLTITENLTIAQRKVLGR
SEAEATKKGLALLDRVGLSAHAKKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALD
PEMVSEVLDVMVQLAQEGMTMMCVTHEMGFARKVANRVIFMDKGSIIEDCTKEEFFGDQS
ARDQRTQHLLSKILQH
NT seq 771 nt   +upstreamnt  +downstreamnt
gtggctggtcaagcgcctgcaaaaaaggatctccgtatgatttccatcaagaacgtcaac
aagtggtacggcgacttccaggtactgaccgactgcagcaccgaggtcaagaaaggtgag
gtggtggtggtctgtggcccgtcgggctcgggcaagtccaccctgatcaagtgcgtcaac
gcgctggagccgttccagaagggcgacatcgtggtcgatggcacttcgattgccgacccg
aagaccaacctgcccaagctgcgctcgcgcgtgggcatggtgttccagcacttcgagctg
ttcccgcacctgaccatcaccgagaacctgaccattgcccagcgcaaggtactgggccgc
agcgaggcggaagccaccaagaagggcctggcgctgctcgaccgtgtaggcctcagtgcc
catgccaagaaacaccccggccagctctccggtggccagcagcagcgcgtggcaatcgcc
cgcgccctggcgatggacccgatcgtcatgctgttcgacgaacctacctccgcactggac
ccggaaatggtcagcgaggtactggacgtgatggtgcaactggcccaagaaggcatgacc
atgatgtgcgtaacccacgagatgggctttgcccgcaaagtcgccaaccgggtcatcttc
atggacaagggcagcatcatcgaagactgcaccaaggaagagttcttcggtgaccagagc
gcccgcgaccagcgcacccagcacctcctcagcaagatcctgcagcactga

DBGET integrated database retrieval system