KEGG   Pseudomonas putida KT2440: PP_1070
Entry
PP_1070           CDS       T00114                                 

Gene name
gltJ
Definition
(RefSeq) glutamate/aspartate ABC transporter permease
  KO
K10003  glutamate/aspartate transport system permease protein
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu02010  ABC transporters
ppu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PP_1070 (gltJ)
  09132 Signal transduction
   02020 Two-component system
    PP_1070 (gltJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppu02000]
    PP_1070 (gltJ)
Transporters [BR:ppu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter
    PP_1070 (gltJ)
SSDB
Motif
Pfam: BPD_transp_1 SPC25 ENOD93
Other DBs
NCBI-GeneID: 1044967
NCBI-ProteinID: NP_743231
UniProt: Q88NY3
Position
complement(1224678..1225424)
AA seq 248 aa
MNYNWDWGVFFKSTGVGSETYLDWYITGLGWTIAIAITAWIIALLLGSLLGVMRTVPNRL
VSGIATAYVELFRNVPLLVQLFIWYFLVPDLLPEGLQEWFKQDLNPTTSALISVVICLGL
FTAARVCEQVRTGIQALPKGQEAAARAMGFSLPQIYNNVLLPQAYRIIIPPLTSEFLNVF
KNSSVASLIGLMELLAQTKQTAEFSANLFEAFTLATLIYFTLNMGLMLLMRMVEKKVAVP
GLISVGGK
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaattacaactgggactggggcgtgttcttcaagtccaccggcgtgggcagcgaaacc
tatctggactggtacatcaccggcctgggctggaccatcgccatcgccatcaccgcctgg
atcatcgcgctgctgctggggtcgctcctcggtgtcatgcgtaccgtaccgaaccgcctg
gtatcgggtatcgccaccgcctacgtggaactgttccgcaacgtgccactgctggtgcaa
ctgttcatctggtacttcctggtaccggacctgctgccagaaggcttgcaggaatggttc
aagcaggacctcaacccgaccacttcggcgctgatcagcgtggtcatctgcctgggcctg
ttcaccgccgcgcgcgtctgtgagcaagtgcgtaccggtatccaggcgctgcccaaaggc
caggaagctgccgcccgcgccatgggcttcagcctcccgcagatctacaacaatgtgctg
ctgccgcaagcctaccggatcatcattccgccgctcacctccgagttcctcaacgtattc
aagaactcctcggtggcgtcgctgatcggcctgatggagctgctcgcgcagaccaaacag
accgcagagttttccgccaacctgttcgaggcgttcaccttggccacgctgatctacttc
accctgaacatgggcctgatgctgctcatgcgcatggtcgagaagaaagtcgccgtgcct
ggcctgatttccgtggggggcaagtaa

DBGET integrated database retrieval system