KEGG   Pseudomonas putida KT2440: PP_1071
Entry
PP_1071           CDS       T00114                                 

Gene name
gltI
Definition
(RefSeq) glutamate/aspartate ABC transporter substrate-binding protein
  KO
K10001  glutamate/aspartate transport system substrate-binding protein
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu02010  ABC transporters
ppu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PP_1071 (gltI)
  09132 Signal transduction
   02020 Two-component system
    PP_1071 (gltI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppu02000]
    PP_1071 (gltI)
Transporters [BR:ppu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter
    PP_1071 (gltI)
SSDB
Motif
Pfam: SBP_bac_3 NMT1 DUF3834
Other DBs
NCBI-GeneID: 1044664
NCBI-ProteinID: NP_743232
UniProt: Q88NY2
Position
complement(1225570..1226490)
AA seq 306 aa
MMRIVRQLLGAAIAAAVIASPAMAEELTGTLKKIKESGTITLGHRDSSIPFSYLAGKPEP
VGYSHDIQLAVVDALKKQLGTDIKVRYNLVTSQTRIPLVQNGTVDLECGSTTNNVERQQQ
VGFSVGIFEVGTRLLTKVKDGQPAYKDFPDLAGKNVVTTAGTTSERILKAMNADKQMKMN
VISAKDHGEAFNMLESGRAVAFMMDDALLAGEMAKARKPADWVITGTPQSYEIYGCMVRK
DDAAFKKAVDDAIVAYFKSGEVNKSYEKWFMQPIPPKGLNLNFQMSEELKKLIAEPTDKA
ADEKKS
NT seq 921 nt   +upstreamnt  +downstreamnt
ttgatgcgtatcgttcgtcaattgctgggcgcagccatcgcggctgcagtcatcgcttcg
ccggccatggccgaggagctcaccggcaccctgaagaagatcaaggaatcgggcaccatc
acgctggggcaccgcgactcctccattccattttcctacctggccggcaaacccgagccc
gtcggttactcgcatgacatccagctggccgtcgtcgacgcgctgaaaaagcaactgggc
acggacatcaaggtccgttacaacctggtcacctcgcaaacccgtattccgctggtgcag
aacggcaccgtcgacctggagtgtggctccaccaccaacaacgtcgagcgccagcaacag
gttggcttctcggtcggcatcttcgaagtcggtacccgcctgttgaccaaggtcaaggac
ggtcagccggcatacaaagacttcccggacctggccggcaagaacgtggtgaccaccgcc
ggtaccacctccgagcgcatcctcaaggcgatgaacgccgacaagcagatgaagatgaac
gtgatttccgccaaggaccacggtgaagccttcaacatgctcgaaagcggccgcgccgtg
gccttcatgatggacgacgccctgctcgccggtgaaatggccaaggcgcgcaagccagcg
gactgggtcatcaccggtacccctcagtcgtacgaaatctacggctgcatggtgcgcaag
gatgacgctgcgttcaaaaaagcggtcgacgacgccatcgttgcctacttcaagtcgggc
gaagtcaacaagagctacgagaagtggttcatgcagccgatcccgcctaaaggtctgaac
ctcaacttccagatgagcgaagagctgaaaaaactgatcgccgagccgaccgacaaggct
gcggacgagaagaagtcctga

DBGET integrated database retrieval system