KEGG   Pseudomonas putida KT2440: PP_1597Help
Entry
PP_1597           CDS       T00114                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00900  Terpenoid backbone biosynthesis
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PP_1597 (dxr)
Enzymes [BR:ppu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PP_1597 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-GeneID: 1045056
NCBI-ProteinID: NP_743754
UniProt: Q88MH4
Position
1790071..1791285
Genome map
AA seq 404 aa AA seqDB search
MGCRMGCDVSRPQRITVLGATGSIGLSTLDVIARHPDRYQAFALTGYSRIDELLALCVRH
RPAFAVVPSTEAAVRLRASLAAAGCTTEVLEGEAGLCQVASAAEVDAVMAAIVGAAGLRP
TLAAVEAGKKVLLANKEALVMSGALFMEAVRQKGAVLLPIDSEHNAIFQCMPGDYARGLS
AVGVRRILLTASGGPFRETPVEALLDVTPEQACAHPNWSMGRKISVDSASMMNKGLELIE
ACWLFDAVPSKVEVVVHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPERIDSGV
APLDLFAIARLDFQAPDEQRFPCLRLARQAAEAGNSAPAVLNAANEVAVQAFLERRIRFP
EIAGMIEQVLDQEPVVPLPSLDAVFAADQRARELSREWLRRHGR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgggctgccgaatggggtgtgatgtgagtcgcccgcaacgtattaccgtgctcggggcc
accggctccattggcctgagtacgctggatgtgattgcgcgtcatcctgaccgttatcaa
gcgttcgccctcactggctattcgcgcatcgacgagctgttggcgctatgcgtgcgtcat
cgtccggccttcgctgtggtgccgagcaccgaggcggcggtgaggttgcgtgcgagtctg
gctgcggccggttgcaccaccgaggtgctggaaggtgaggccgggctttgccaagtggcg
tcggccgctgaagtggatgcagtgatggcagccattgtcggtgctgccggcctgcgcccc
acgctggcggcagtcgaggcaggcaagaaggtgttgctggccaacaaggaagcacttgtg
atgtccggcgcactgttcatggaggcggtgcggcaaaagggtgccgtgctgctgccgatc
gacagcgaacacaacgctatcttccagtgcatgccaggcgactacgcccgtggcctgagt
gccgtcggtgtgcgccggatcctgcttaccgcgtccggcgggccgttccgcgaaacgccg
gtcgaggcgctgctggacgtgactccggagcaagcctgtgcgcaccccaactggtccatg
gggcgcaagatctccgtggattcggccagcatgatgaacaaaggcctcgagttgatcgaa
gcctgctggttgttcgatgccgtgccgtccaaggttgaggtggtggtgcacccgcagagc
gtgatccactcgctggtcgactacgtggacggttcggtactcgcgcagttgggcaacccg
gacatgcgtacgccaatcgccaacgcgttggcctggccggaacggatcgattccggggtt
gccccgctggacctgttcgccatcgcccgtctggatttccaggcgcccgacgaacaacgc
ttcccttgcctgcgccttgcgcggcaggctgccgaggccggcaacagcgcgcctgccgtg
ctcaatgcggccaacgaagtcgcggtccaggcatttcttgaacggcgcatccgcttcccg
gagatcgcgggtatgatcgaacaggtactcgaccaggaacccgtcgtaccgctgccgtcg
ctggatgcggtatttgccgccgatcagcgtgcccgggagctttcccgtgagtggctgagg
cgtcacggccgctga

DBGET integrated database retrieval system