KEGG   Pseudomonas putida KT2440: PP_2615
Entry
PP_2615           CDS       T00114                                 

Gene name
hcpC-I
Definition
(RefSeq) hemolysin-coregulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu02025  Biofilm formation - Pseudomonas aeruginosa
ppu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PP_2615 (hcpC-I)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PP_2615 (hcpC-I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppu02044]
    PP_2615 (hcpC-I)
Secretion system [BR:ppu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PP_2615 (hcpC-I)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 1046004
NCBI-ProteinID: NP_744759
UniProt: Q88JN4
Position
complement(2991554..2992069)
AA seq 171 aa
MPTPAYIKIVGQTQGNITAGAFTADSVGNVFQQGHEDQILVQEIKHEVTTPTDPQSGQPS
GQRVHKPFIFTSSLNKATPLMYQALANGEMLPTVEVSWYRTSSEGKQEHFFTTTLEDATI
VSINTVLPHALDKDNENYTQLVEVSLAYRKITWAHDVANTEGSDDWRAPAA
NT seq 516 nt   +upstreamnt  +downstreamnt
atgccaacacccgcttacatcaagatcgtaggccagacccaaggcaacatcaccgctggc
gccttcaccgctgactccgtcggcaacgtgttccaacaaggccatgaagatcagattctg
gttcaggaaatcaagcatgaggtgactacgcccactgacccccagagcggtcaaccgagt
ggccagcgcgtgcataagcctttcatattcaccagttcactgaacaaagctacccccctg
atgtatcaggcacttgccaacggcgaaatgctgccaacggtcgaggtcagctggtatcgc
acctcgtcggaaggcaaacaagagcattttttcaccaccacgctcgaagacgccaccatc
gtcagcatcaataccgtgcttccccacgcactcgacaaagacaatgaaaactacacccaa
ctggttgaagtatcgctggcgtatcgaaagatcacgtgggctcacgatgtagccaacacc
gaaggctctgacgactggcgcgcacccgccgcctga

DBGET integrated database retrieval system