KEGG   Pseudomonas putida KT2440: PP_2627Help
Entry
PP_2627           CDS       T00114                                 

Definition
(RefSeq) membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu02025  Biofilm formation - Pseudomonas aeruginosa
ppu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PP_2627
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PP_2627
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppu02044]
    PP_2627
Secretion system [BR:ppu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PP_2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C
Motif
Other DBs
NCBI-GeneID: 1046016
NCBI-ProteinID: NP_744771
UniProt: Q88JM2
Position
3003420..3007040
Genome map
AA seq 1206 aa AA seqDB search
MNQIWTQLKRWGWPWVTRIGLALPLLLGLGALLMLVAIWWLGPQWTWREQQPLASVAHRS
VASLVLVLVPLLCWLGVLRTRFRRLQAERRQALAAEQDVALPFVQAQERALSQGLERYLD
NAGGRRALYRLPWYLVLGDEQSGKSSFIDRTDQRFTLTRIDQAQARGRQTQAMAYPVGWW
VSDDAVIIDPPGVFISQKPPVGSAANAPSEASAPPGIQARLWEHLLGWLQRKRSQRALNG
VLLVVDLPALLHGRPEQRVALAHGLRTRLYEVSSQLGARLPLYVVLTKFDLLDGFDQFYS
QLPAAKRKSLLGFTFKLDAVDAFDAWLDEYDEHYGRLLTQLQEQVIDRLDVLGKTAPCGR
LFSLHAQLIGLRPILQAFLRETLASDRFTTPPLVRGVYWSSVVQQGDMRNAFVREAAQPY
TTKLPLREGKAQGKALVYFIQQAFRRVIYQEAGLAGDNVRVARSKRHLLWVGSGVGILAF
SIAVASWQRYADINGAKAASVLAKSQEYSGHEVDMRLDPTGRNLLAPLDQIRDAVAVFGD
YRAAWPVVADFGLYQGRNIGPLVDEAYLSLLSKRFLPALASGVIDAMNAAPPGSEQQMAA
LRVYRMIEDRNSRRPEWVEDWMARQWQRAFPGQGQLQRDLMQHLKYALAYADTDLPQYRQ
RVSEVQQALRKLPLPQRVYAGLKQQSYQQLHAGLDLRHQVGPAFDVVYQPSSGARQGDED
VRLAAMLTAKGFREYFEPHSQRFAEMAMVDQWALGERSQLDYSDVDRDALTERLYNLYSA
DYIDSWRRALTAFTVADFRDLDHGVAILEQLTGPAAPLQRLLDTVRDNTSLAPPAAVEAS
GELSTLRVATGKPEQQQALAIQRAFAGLGAMLQATGEKPSYYDETLGAVAAVLDYAKAVQ
DSPDRGKAALQAVHQRFAMTGQDPIGTLQRIATGLPEPISHQVRKLADQTAQVLNVEALR
ELERRWDADVYSFFQQRLAGRYPFVVKAPDASLDDFEAFFGPKGRLQQFNDRYLKVFLKD
NLEALQSAQHGQSLIRADVIEQLELAERIRETFFDQRGKLSVQFSIEPLGLSANQRTSLL
DLDGQLIAYTHGPSHITGIVWPNTLGQQVRSNLTLLRQNGNSSSLEYRGPWSMFRLLSRG
ALNGRTATSVDLSFRTGDGVMRYRLNAEKAFNPITQQPFKGFRLPRGLLQQPASVVQAVL
PDGQRL
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaatatggacgcaactcaaacgttggggctggccgtgggtaacgcgcattggc
ctggcgctgccgctgctgctcgggcttggcgccttgctgatgctggtcgccatctggtgg
cttggcccgcaatggacgtggcgtgagcagcagccgctggcaagtgtggctcatcgcagc
gtggcaagcctggtgctggtgctggtgccgcttctgtgctggcttggggtgctgcgcacg
cgctttcgccgcctgcaagcggagcgccgccaggcactggccgccgaacaggatgtcgcg
ctaccattcgtgcaggcgcaagagcgggccttgagccaggggcttgagcggtacctcgac
aatgccggtgggcgacgcgcgttgtaccggctgccctggtacctggtgttgggcgacgaa
cagtccggtaaaagcagcttcatcgaccgcaccgatcagcgctttaccctgacgcgtatc
gaccaggcccaggcacggggccgacagactcaagcaatggcctacccggtaggctggtgg
gtcagcgacgatgccgtgatcatcgacccgcccggtgttttcatcagtcaaaaaccaccg
gtgggctcggcggccaacgccccctccgaagcctccgcgccgcccggcatccaggcccgg
ttatgggagcacctgttgggctggctgcagcgtaagcgaagccagcgggcgctcaatgga
gtgttgctggtggtcgacctgccggcgttgctgcatggcaggcccgagcagcgcgtcgcg
ctggcccatgggttgcgcacacgcctgtacgaagtgagcagtcagttgggggcgcgcctg
ccgctgtacgtggtactgaccaaattcgatctgctggacggcttcgaccagttctacagc
cagcttccggccgccaagcgtaaaagcctgttggggttcaccttcaagctggatgcggtt
gacgcgttcgacgcctggctggatgagtatgacgagcactacgggcggcttctcacccaa
ttgcaggagcaggtcatcgaccggctggatgtactgggcaagacagcgccgtgcgggcgc
ctgttctcactgcatgcacagttgatcgggttgcgccccatactgcaggcattcctgcgc
gaaaccttggcgagtgaccggttcaccacgccacccttggtacgtggtgtgtactggtcg
tcagtggtacagcaaggcgacatgcgcaatgcctttgtccgagaagcggctcagccctac
acgacgaagctgcccctgcgtgaaggtaaggcacaggggaaggcgttggtctatttcatc
cagcaagcattcaggcgggttatctatcaggaagccgggctggcgggtgacaatgttcgg
gttgcgcgcagcaagcgccacttgctgtgggtgggctctggtgtaggcatcctggcgttc
agtatcgccgttgccagctggcagcgttacgccgacatcaatggcgccaaggctgccagt
gtgctcgccaaaagccaggagtacagcggtcacgaagtcgatatgcgtcttgatccgacc
gggcgcaacctgctggcgccactggaccagattcgcgatgcggtcgcggtgtttggcgac
tatcgtgcggcctggccggtggttgccgattttggcttgtatcaagggcgcaacattggt
cccttggttgatgaggcgtacctcagcttgttgtctaaacgtttcttgccggccttggcc
agtggtgtgatcgatgccatgaacgcagcaccacctggcagcgagcaacaaatggccgcg
ctcagggtttaccggatgatcgaggaccgcaacagccgccggcccgaatgggtcgaggac
tggatggcccgtcagtggcaacgggcctttcctggccaggggcagttgcagcgtgacctc
atgcagcacctgaaatacgccttggcctatgccgataccgatttgccgcagtaccgccag
cgggtcagcgaagtgcagcaggcgctgcgcaaattgccgttgccacagcgggtctatgca
gggctgaaacaacaatcgtaccagcagttgcacgccgggctggacctgcgccaccaggta
gggcctgcgttcgatgtggtgtaccagccgtcttccggggccaggcaaggggatgaggat
gtacggctggccgccatgctcaccgccaaaggcttcagggaatacttcgagccgcacagc
caacgcttcgctgaaatggcgatggttgatcaatgggcattgggggagcgcagtcaactc
gactattcggacgtcgaccgcgatgcgctgaccgagcggctgtataacctctacagcgcc
gattacattgacagctggcggcgcgccctgaccgcttttacggtggctgacttccgtgat
ctggaccatggtgtcgcgatcctggagcagttgaccggccccgcagcaccattgcaacgg
ctgctggatacggtcagggataacacctcgcttgcgcctccagcagctgttgaagcatcg
ggtgagctgagtacgctgcgcgtagcaaccggaaaacccgagcaacagcaagcgttggcc
atccagcgggcgtttgcaggccttggcgccatgctgcaggcgacaggagaaaagccgagc
tactacgatgaaacccttggcgctgttgcggccgtgctggactacgccaaggccgtacag
gacagcccggaccgcggcaaggctgctttgcaggccgtgcatcagcgctttgcgatgaca
gggcaggacccgataggcaccctccaacgtattgccacaggtttaccggagcctatcagc
caccaggtcagaaagctcgccgaccagactgcccaggtgctgaacgttgaagcactgcgc
gaactggagcgacgttgggatgctgacgtgtacagttttttccagcaacgcctggcaggc
cgctacccctttgtggtgaaggcacccgatgcttctttggatgacttcgaggcgttcttc
gggccgaaagggcgcctgcagcagtttaatgatcggtatctcaaggttttcctgaaggac
aaccttgaggccttgcagtccgctcagcacgggcaatccctgattcgtgccgacgtgatc
gagcagctcgagctggcggagcgcatccgcgaaaccttcttcgatcagcgtggcaagcta
agtgtgcagttcagcatcgagcccttggggctcagtgcaaaccagcgtaccagcctgctg
gacctggatggccagttgattgcctacacccatgggccaagccatatcacgggtattgtc
tggcccaataccttggggcagcaggtccgcagcaatctcaccttgctaaggcaaaatggc
aacagcagcagcctggagtaccgtggcccgtggtcgatgttccgcttgctcagccgcggt
gcgctcaatggccggacggcgaccagcgtggacctgagcttcaggaccggagatggcgtg
atgcgctatcggcttaacgctgaaaaagccttcaatcccattacccagcaacctttcaaa
ggcttccgcttgccccgaggcttgttgcaacagccagccagtgtggtgcaggcggtgcta
ccggatgggcagcgactatga

DBGET integrated database retrieval system