KEGG   Pseudomonas putida KT2440: PP_3088
Entry
PP_3088           CDS       T00114                                 

Name
(GenBank) conserved protein of unknown function
  KO
K11902  type VI secretion system protein ImpA
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PP_3088
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppu02044]
    PP_3088
Secretion system [BR:ppu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PP_3088
SSDB
Motif
Pfam: ImpA_N DUF2514
Other DBs
NCBI-ProteinID: AAN68696
UniProt: Q88IB1
Position
complement(3476880..3477965)
AA seq 361 aa
MPEILNDLSLATLVAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWE
QVINLSAQGLAQQSKDLMLVAWLCEGLAQREHFEGITFGLELTEQLLVAFWETLYPTLED
GLDERAARLSWLKTTLTDIAGGLPIIQGQNFGVLRYDESRHVENLALQNPKAMQTALNEG
KINAEIFQRSVALTDTDYLRAKAQQIATSLNACKRLQASADRLFGHEAPSFASLADMLSR
ASQLAEKLLKDRGVELHPAIPEEAQPQAMAANLHEAGEPMNATPPTTAPAALRTTPLTRD
EAFTMLAGIAQYFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDNNVVDNIRDVLGT
R
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgcctgaaattctcaatgacctctcgctggccacactggtcgcccctatcgagggtggc
agtggcgaagacttgagcttctctgccttgttcgatcagatcaaggaggcacgccgggcg
gaccctgactacctgacccagggcgactggcaaaccgacttgaagactgccgactgggag
caggtgatcaacctgtcggctcaagggcttgcgcagcaaagcaaagacctgatgctggtg
gcctggctctgcgaggggctggcccagcgtgaacacttcgaaggcatcacctttggcctc
gagctgaccgaacagctcctggttgcgttctgggaaacactgtaccccaccctcgaagac
ggcctggacgagcgcgcggcgcgactgtcctggctgaagaccacgctcaccgacattgcc
ggtggcttgcccattatccaggggcagaattttggcgtgttgcgctatgacgaatcacgc
catgtagagaacctcgccttgcaaaaccccaaggcgatgcagacagcactgaacgaaggc
aagatcaacgccgagatcttccagcgctcggtagcgcttaccgacaccgattacctgcgc
gccaaggcgcagcagatcgctaccagcctgaatgcatgcaaacgcctgcaggccagcgcc
gaccgcctgttcggccacgaggcgcccagctttgccagccttgccgacatgctttcgcgt
gccagccagctggcggaaaaactgctcaaggaccgcggcgtagagctacaccccgccatc
ccggaagaagcacagccacaggccatggctgccaacctccacgaagcaggtgagccgatg
aatgccacgcccccgacgaccgcgcctgcagccctgcgcaccaccccgctgacccgcgac
gaggcattcaccatgcttgcgggcatcgcccagtacttcaaacagagcgaaccgcaaagc
ccggtaccctacctgatcgaacgtgcgatcaagtggggcaacatgccgttggaaggctgg
ttgagtgacgtgatcaaggacaacaatgtggtggacaacatccgcgatgtgctgggcacc
cgctag

DBGET integrated database retrieval system