KEGG   Pseudomonas putida KT2440: PP_3091
Entry
PP_3091           CDS       T00114                                 

Definition
(RefSeq) membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu02025  Biofilm formation - Pseudomonas aeruginosa
ppu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PP_3091
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PP_3091
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppu02044]
    PP_3091
Secretion system [BR:ppu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PP_3091
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C MMR_HSR1 AAA_16
Other DBs
NCBI-GeneID: 1043910
NCBI-ProteinID: NP_745235
UniProt: Q88IA8
Position
complement(3482120..3485923)
AA seq 1267 aa
MKTLLRLLKSFWLLLPLLWLASLLICWLAAPLVPWLRHHVPEALAIISACFLLVIVLRQY
QRIRAEHNLENLLQIEVDRSWNATGEFRDQQVLRERLKHAITMLRTDRSAGGGGKAALSD
LPWYLVVGMSAAGKTSLLTHSGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRD
DQSASEFSAFLRMLRKQRGKAAINGLVLVVSLPELLAANSDERNALAAQLVARVEEYAEC
LDANPPVYLMLSKTDQLPGFSQAFDGLDLHERQQPLGMTFGLSEIRTNGLHAVLQTRLKK
LQAHIRQHVDAQMIALGAEADSTLLNFPQYFAALSGVLEQFLEHFTRGHRGGAPLLLRGL
YFTSALQNGQQLGQVYEDVIADEFALQAAYDEQAGHVGKALGNRSYFITDTFRQVIFPDR
DLILYQSRLGRQAAFSPLLLGLAAATGLLFIGWQALSFANNRQWLDSLRGQLAHIEQAAD
REQQLAAGKGLEVLREQMANVKAHRLQGVPLQLGGGLYQGEAIHQVTRSAYLAQLRSQAL
EPIARSLQVQMRAFNTFANGINQELEFTPAPQPKKRNGKPLAPAIAARAKAALGNTRAGA
YAAKVNLATASDGAELSAATGGLSLSEEMLGRLDEQQVASIIEAYNTLKLYLLLTEPQAH
PDPAFVAASLPQAWASAAGEGTPADAGVIAENAPLYVQLLEQGQAPSLPRNEQLINETRQ
NLKSFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRALLYGTAGVPAIYTRQGWD
TFVKPELIKLVSGNLRNESDWVLDGEGGDALVQKANFVREFMTRYKRDYTQAWYKMVSSV
GVRHFADLASATRELGLLSDVQNSPVKNLLQAVNDNTQWDLPVKQAIPAPGTSRDDGFWS
KVTGLFDANDTLPANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALR
KLKVRMNNIQRSQDVGKSSKQLISETLEGQPSEITTVRNYVESSVDTSQDGLSRSLQGLF
SLPIQYAWATLRDPAGEQIAKAWAQQIAKPWEQVMAHRYPIAGSSRNEASVKDLQRFVDP
DSGLLPAFKRNEIGNLAGGEGLGVGDGKGPALVNPGMLNSIDKASSVGQVIASLSDRDNG
FEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPGTSTAPGARLDVVTLSGTRVTV
FDFPGRWGLLRMNESARVDDLDGIQQRFSWNTASGRVSLVVRNFGGVKLTDLGDVKALSA
LNSRGAQ
NT seq 3804 nt   +upstreamnt  +downstreamnt
atgaaaacattactgcgtctgttgaaaagtttctggttgctgctgccattgctgtggctg
gctagcctgttgatttgctggctggccgcgccgctggtgccgtggctgcgtcatcacgtg
cctgaagcgctggcaatcatcagtgcctgcttcctgctggtaatcgtgctgcgccaatac
cagcgtattcgcgccgaacacaacctggagaacctgctgcagatcgaggtcgaccgctcg
tggaatgccactggcgagttccgtgaccagcaggtgctgcgtgagcgcctgaagcacgcc
atcaccatgctgcgcaccgaccgctccgccggtggcggcggcaaggcggccctgtccgac
ctgccctggtacctggtggtcggcatgtcggcggccggcaagacctcgctgttgacccat
tccggcctgtcggccagcatcgctacggccaacgacagtgaaagcggcacccagcactgc
gactggtacttcagccccgacgccgtgatgatcgacaccgccgggcgctacctgcgcgac
gaccaatcggccagcgagttctcggcctttctgcgcatgctgcgtaagcagcgcggcaaa
gcggcgatcaatggcctggtcctggtggtcagcctgcccgaactgctggcggccaacagc
gatgagcgcaatgccctggctgcccagctggtggcccgggtggaagaatacgccgaatgc
ctcgatgccaacccgccggtttacctgatgctgagcaagaccgaccagttgccgggcttc
agccaggctttcgacggcctcgacctgcacgaacgccagcagccgctgggcatgaccttt
ggcctttcggaaatccgcaccaacggcctgcacgccgtgctgcagacgcgcctgaagaag
ctgcaagctcatattcgccagcacgtcgacgcgcagatgatcgccctcggtgccgaagcc
gacagcaccctgctgaatttcccgcagtacttcgccgccctcagcggtgtgctcgagcaa
ttcctcgaacacttcacccgcggccatcgcggcggtgccccgctgctgctacgtggcctg
tacttcaccagtgcactgcagaacgggcagcaactggggcaggtctatgaagacgtcatc
gccgacgaattcgccctgcaggccgcctacgatgaacaggccgggcacgtcggcaaggcc
ctgggcaaccgcagctacttcatcaccgacactttccgccaggtgatcttccccgaccgc
gacctgatcctttaccagtcgcgcctgggccgccaggctgcgttcagcccgctgctactg
ggcctggccgccgccaccgggttgctgttcatcggttggcaagcgctgtcgttcgccaat
aaccgccagtggctggacagcctgcgcgggcagctggcgcacatcgaacaggcagcagac
cgcgagcagcagctggccgcaggcaagggcctggaagtgctgcgtgagcagatggccaac
gtcaaggcccatcgcctgcagggagtgcccttgcagttgggtggcggcctgtaccagggc
gaggcgattcaccaggtgacccgcagcgcctacctggcgcagctgcgcagccaggcgctg
gaaccgatcgcacgcagcctgcaagtgcagatgcgggcgttcaataccttcgccaacggt
attaaccaggagctggaattcaccccggccccgcagccgaagaagcgcaatggcaagccg
ctggcccctgccattgcggccagggccaaggccgcgctgggcaacacccgcgctggcgcc
tatgccgccaaggtcaacctggccactgccagcgatggcgccgagctgtccgccgccacc
ggtgggctgtcactgtccgaagaaatgctcgggcgcctggacgagcagcaggtggcctcg
atcatcgaggcctacaacaccctcaagctgtacctgttgctgaccgagccccaggcccat
ccagacccggccttcgtcgctgccagcctgccccaggcctgggccagcgccgcaggcgaa
ggcaccccggccgacgctggcgtgatcgcagaaaatgccccgctgtacgtgcagttgctg
gagcagggccaggcgccgtcgttgccgcgcaacgaacagctgatcaacgaaacccggcag
aacctcaagtcgttcatgatctccagctcgctggtcgatcgcgaatacctgcgcctgcag
ctcgagtcgagccggcagttcccggcgctgagcctcaacgacctggtcccgcaaccaggc
cgcgcgctgctgtacggaaccgctggtgtgccggcgatctacacccgccagggctgggac
accttcgtcaagcccgagctgatcaagctggtgtcgggcaacctgcgcaacgagtcggac
tgggtgctggacggcgaaggcggcgatgccctcgtgcagaaggccaacttcgtgcgcgag
ttcatgacccgctacaagcgcgactacacccaggcctggtacaagatggtcagcagcgtt
ggcgtgcgccacttcgccgacctggcctcggcgacccgggagctggggctgttgagcgac
gtacagaactcgccagtgaagaacctgctgcaggcggtcaacgacaatacccagtgggac
ctgccggtcaagcaggccatcccggccccaggcaccagccgcgatgacggtttctggagc
aaggtcaccggtctgttcgacgccaacgacaccctgcctgccaacgtcgccccggccctg
ccggcggtggacgacggcagcctggccaagcgcttcgagccggtggcgcgggtgttcgcc
gaaaacaacgccgaaggcgccgacagcaccatcatggatcgctacctggccgccttgcgc
aaactcaaggtgcgcatgaacaacatccagcgctcgcaggatgtgggcaagagcagcaaa
cagttgatcagcgagaccctggaaggccagccgagcgagatcaccaccgtgcgcaactac
gtggaaagcagcgtcgacaccagccaggatggcctgtcgcgctcgctgcaggggctgttc
agcctgcccatccagtatgcctgggcgaccctgcgcgacccggccggcgagcagatcgcc
aaggcctgggcgcagcagatcgccaagccctgggagcaggtcatggcacaccgttacccg
attgccggcagcagccgcaacgaggcttcggtgaaagacctgcaacgcttcgtagatccc
gacagcggcctgctgccggccttcaaacgcaacgaaatcggcaacttggccggtggtgaa
ggtctgggtgtaggcgatggcaaggggccggcgctggtcaaccctggcatgctcaacagc
atcgacaaggccagctccgtgggccaggtgatcgccagcctgtcagaccgtgacaacggc
ttcgaaatcatgctggagccttcagccaacttcaccgacatcgtcttcaccctcgatggc
caggagcagcactaccgcaacggccgcagcagctggaaccgcttcgcctggccgggcacc
agcaccgcgccgggcgcgcgcctggacgtcgtcaccctgagcggcacacgggtcaccgtg
ttcgacttcccagggcggtggggcctgctgcgcatgaatgagagcgctcgggtcgacgac
ctggacggcattcagcaacgcttcagctggaacaccgccagcggccgcgtaagccttgtc
gtgcgcaacttcggcggggtcaagctgaccgatctgggtgacgtcaaggccctgagcgcc
ctcaacagcaggggcgcgcaatga

DBGET integrated database retrieval system