KEGG   Pseudomonas putida KT2440: PP_3099
Entry
PP_3099           CDS       T00114                                 

Gene name
puuD
Definition
(RefSeq) uricase/urate oxidase
  KO
K11900  type VI secretion system protein ImpC
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PP_3099 (puuD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppu02044]
    PP_3099 (puuD)
Secretion system [BR:ppu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PP_3099 (puuD)
SSDB
Motif
Pfam: VipB VipB_2 TssC DUF1002
Other DBs
NCBI-GeneID: 1043952
NCBI-ProteinID: NP_745243
UniProt: Q88IA0
Position
complement(3494711..3496213)
AA seq 500 aa
MTDKQTAPQQAGDLVEVENFAPQPSLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEG
EMTPSKDLIAVLDSRIAEIDAMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLK
IHLLNASKKDLVRDLKAASEFDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMY
LLEEISHVAAAAHAPFISAASSELFGWDSFTEMSGPRDLAKIFDTVEYAKWKSFRASEDS
RYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKYLWMNAAYALGTRVTDAFARY
GWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFIPLVHCK
GTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQ
LDELTASLRLVAELPQGARG
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgaccgacaagcaaaccgcaccgcaacaggccggcgacctggtcgaagtggaaaacttc
gcaccacagccctcgctgctcgacagcatcatttcgcaaagccgcgtggcccgctccgac
accgagcgcaaccgcacccgcgacctgattggcgaactggtgaaccaggtgctcgagggt
gagatgaccccgagcaaggacctgatcgccgtgctcgattcgcgcatcgccgagatcgac
gcgatgctctccgagcagatgaacgagatcatgcacgcccgcgagtttcagcagttggaa
gcctcctggcgcggcctgaaataccaggtagaccagaccgagaccagcaccacgctgaag
atccacctgctcaatgcctcgaagaaagacctggtacgcgacctgaaggccgccagcgaa
tttgaccagagcgcactgttcaagaaggtctacgaagaagagtacggcaccttcggtggc
gcgcctttcggcatgttgatcggtgactacgagttcaaccgcaaccctgaagacatgtac
ctgctcgaagagatctcgcacgtcgcggcggcggcgcacgcgccgttcatctcggccgct
tcgtccgagctgttcggctgggactcgttcaccgagatgtccggcccgcgtgacctggcg
aagatcttcgacaccgtggaatacgccaagtggaagtcgttccgcgcctcggaagactcg
cgttacgtcggcctcaccctgccccacgtgctcggtcgcctgccgtatggaccggatacc
accccggtggaagaattcaacttcgtcgaaagcgtcgatggccgcgaccacaacaagtac
ctgtggatgaacgccgcctacgccctcggcacccgggtcaccgatgccttcgcccgctac
ggctggtgcgtggccatccgcggcgtggaaggtggcggcctggtcgaaggcctgccgacc
cataccttcaagaccgacgacggcgaaatcgccctcaagtgcccgaccgaaatcgccatc
accgatcgccgcgaaaaagagctgtcggacctgggcttcatccccctggtgcactgcaag
ggcaccgactatgccgcgttcttcggcacccagtcggcgcagaaacagaagcagtacaac
accgacatcgccaacgccaacgcacgcctgtcggcccagctgcaatacatcttcgccact
tcgcgcatcgcccactacatgaaggcgatcatgcgcgacaagatcggcagcttcgcctcg
cgcatggatgtcgagcgcttcctcaaccagtggctggccagctacgtgctgctcgacgat
accgccagccaggaggccaaggccaagttcccgctgcgcgaagcccgcgccgaggtgttc
gaagtgcccggcaagccaggcgtgtacaaggccgtgacctacttgcgcccgcactaccag
ctggatgagctgaccgcctcgctgcggctggttgccgagctgccacagggcgcgcgcggc
tga

DBGET integrated database retrieval system