KEGG   Pseudomonas putida KT2440: PP_3106
Entry
PP_3106           CDS       T00114                                 

Definition
(RefSeq) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PP_3106
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppu02044]
    PP_3106
Secretion system [BR:ppu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PP_3106
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C DUF2345
Other DBs
NCBI-GeneID: 1043953
NCBI-ProteinID: NP_745250
UniProt: Q88I93
Position
3508373..3510229
AA seq 618 aa
MLTDVLSMLAPQNRRLFKLNILTQTANDEFLLEHFSGTEELSKLYEFDLALLSQQSDVKL
KSLIGSQATVEIELSNGSFRHINGYVQRFSTQGSDGGYVRYAAVLGPWLWMLTCRFDTRI
FQEKSVQAVVSEVFAGFGTLAKYEFRVSKPLKSHSYITQYRESDFNFVQRLLESEGLFYY
FEHTADSHLMVITDDSSTLLPLPEQPQIRYHSASVTETADSITQWQSTRQLQSGQIAVRT
FDYRQPRNFLPVTMQSLNQQGDVDRFEIYDFPGQYTHGSYEDGEAIVRNRIEALELMGKT
FYGESNCRAMKPGYTFELTQHYLHDTGAAENRKFLLLSVEHRGSNNYMTGDQAGYVNRFV
CVRKKIAYRPQLNTRKPLINGPQTAIVVGPPGEEIFTDELGRVKLQFHWDRQGQFNDQSS
CWVRVAQSGASGGFGSIQIPRVGDEVVVVFLDGNPDRPLIMGSLYNSTNTPPWSLPANKT
QSGFLTRSMKGDGGTANFFRFEDKAGAEQIIMHAERNMDTEIELDETHDVGNNRSITVGG
THTETVKKDTVVQVTEGSYTLQVDNQFIQVAAKQHIILQVGDSSITLTPEGIEIKGKVIV
TTSTDTTQITGAAVRIND
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgctaactgacgttctttccatgctcgcgccgcaaaacaggcgattgttcaagctgaat
atcctgacacaaacagccaacgatgagtttttgctggagcacttttccggcactgaagag
ctttccaaactctatgaattcgatctggccttgctcagccaacagagcgatgtaaagctc
aagtcactgattggcagccaggccacggtagaaatagagttatccaacggctctttccgc
cacattaacggctatgttcagcggtttagcacccaaggcagcgacggcggctatgtgcgt
tatgcagccgtgctagggccgtggctgtggatgctgacttgccgtttcgatacacgcatt
tttcaagaaaaatcggtccaggctgttgtcagtgaagtgttcgccggatttggcacgctg
gccaagtacgaatttcgtgtaagcaagccgctcaaatcgcacagctacattacccagtac
cgcgagagcgatttcaactttgtgcagcgcttgcttgagagcgaagggcttttctactac
ttcgagcacacggccgactcccacctgatggtcatcaccgatgactccagcaccttgttg
ccgctgcccgaacagccgcagattcgctaccactccgcgtcggttaccgaaaccgctgat
tccattactcagtggcagtcaacgcggcagctgcaatccggtcaaattgccgttcgcacg
ttcgactatcgccaaccgcgcaacttcctacctgtgaccatgcaaagcttgaatcaacag
ggcgatgtggacaggttcgagatttatgatttcccgggccagtacacccatggcagctac
gaagatggcgaagccatcgtacgcaaccgtatcgaagcgctcgagttgatgggcaagacc
ttctacggcgagagcaattgccgggccatgaagccgggttacacttttgagttgacccag
cattatctgcacgacaccggtgccgccgagaaccgtaagtttttgttgctgagcgtggag
catcgcggcagcaacaactacatgacgggcgaccaggccggttacgtcaaccgattcgtg
tgcgtgcgtaaaaaaatcgcataccgcccgcagttgaacacccgcaagcctttgatcaac
ggcccgcagaccgccatcgttgtcggccccccaggcgaggaaatcttcaccgacgaactg
ggccgggtaaagcttcagtttcactgggatcgccaggggcagttcaacgatcaaagctcc
tgctgggtacgtgtcgcccagtccggtgccagcggtggcttcggcagcatccagattccg
cgcgtaggcgacgaagtggtggtggtgttcctggacggcaacccggaccggccgctgatc
atgggcagcctgtacaacagcaccaacaccccgccatggtcgctgccggcgaacaagacc
cagagtgggttcctgacgcggtcgatgaagggcgacggcggtaccgccaacttcttccgc
ttcgaggacaaggccggcgccgagcagatcatcatgcatgccgagcgcaacatggatacc
gagatcgagctggatgagacccacgatgtggggaataaccgctcgattactgttggtggt
acgcataccgaaacggtcaagaaagacaccgtggtgcaggtgaccgagggttcctacacc
ctgcaggtcgacaaccagttcatccaggtggccgccaagcagcacatcatcctgcaggtg
ggcgacagcagcatcacgctgaccccggaaggcatcgagatcaaaggcaaggtcatcgtg
accaccagtaccgacaccacccagatcactggcgccgcagtgcggatcaacgactga

DBGET integrated database retrieval system