KEGG   Pseudomonas putida KT2440: PP_3376Help
Entry
PP_3376           CDS       T00114                                 

Gene name
ptxD
Definition
(RefSeq) phosphonate dehydrogenase
  KO
K00032  phosphogluconate 2-dehydrogenase [EC:1.1.1.43]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00030  Pentose phosphate pathway
ppu00480  Glutathione metabolism
ppu01100  Metabolic pathways
ppu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PP_3376 (ptxD)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PP_3376 (ptxD)
Enzymes [BR:ppu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.43  phosphogluconate 2-dehydrogenase
     PP_3376 (ptxD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored XdhC_C DUF4440 IlvN
Motif
Other DBs
NCBI-GeneID: 1047015
NCBI-ProteinID: NP_745516
UniProt: Q88HI1
Position
complement(3820918..3821880)
Genome map
AA seq 320 aa AA seqDB search
MKKRIVLYKRLSDDLMARLQDRVEVTWVDTTQPDALARLRDALPGAHGLLGASLRLDASL
LDLAPQLEVVSSVSVGVDNYDIAELSRRGVMLTNTPDVLTETTADTGFALILATARRVVE
LANWVRDGRWQANLGPAHFGSDVHGKTLGIVGMGRIGEALARRAAAGFGMRVLYHSQRAK
PEVEARYAACQCSLDELLQQADFVCLTVPLSASTEGLIGARELALMKPDAILVNISRGRV
VDEQALIEALRARRIRGAGLDVFVHEPLPIDSPLLQLDNVVATPHIGSATEETRQAMARC
AVDNLLSALAGERPVNLVNG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcgaatcgtcctgtataaacgcctgtccgacgacttgatggcacgcctgcaa
gatcgcgtcgaggtgacctgggtggacaccacccagcccgatgccctggcccgcctgcgc
gatgcgttaccgggggcgcacgggttgttgggggccagcctgcgcctggatgccagcctg
ctcgaccttgccccgcaactggaagtggtgtcgagcgtttcggtaggcgtggacaactac
gacattgctgaactcagcaggcgtggtgtgatgctcaccaacacgcccgacgtgttgacc
gaaaccacggccgacacaggctttgccttgatcctggctaccgccaggcgggtggtggag
ctggcgaactgggtgcgtgacggccgttggcaggccaacctggggccggcgcattttggc
agtgatgtgcatggcaagacgctaggcatcgtcggcatgggccgcattggcgaggccctg
gcccggcgcgcggccgctggttttggcatgcgcgtgctgtatcacagccagcgtgccaag
cccgaggtggaagcacgctatgccgcatgccagtgcagcctggatgagctgttgcagcag
gcagatttcgtttgcctgacggtgccattgagcgccagcaccgaaggcctgataggcgca
cgggaacttgcgttgatgaagcctgacgcaatactggtgaacatctcacgcgggcgtgtg
gtggatgagcaggcgctgatcgaagcgctgcgggccaggcgcatccgcggtgcggggctg
gacgtgttcgtgcacgagccactgccgatcgactcgccgctgttgcagctggataacgtg
gtagcgaccccgcatatcggctcggcgaccgaggaaacccgccaggccatggcgcgttgc
gcggtggacaacctgctcagcgcgctggccggtgagcggccggtaaacctggtcaacggc
tga

DBGET integrated database retrieval system