KEGG   Pseudomonas putida KT2440: PP_4076
Entry
PP_4076           CDS       T00114                                 

Definition
(RefSeq) hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
ppu  Pseudomonas putida KT2440
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppu02044]
    PP_4076
Secretion system [BR:ppu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PP_4076
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-GeneID: 1042173
NCBI-ProteinID: NP_746201
UniProt: Q88FL4
Position
4604171..4604581
AA seq 136 aa
MSGFFDRLMADPSAIREASRQESASHKFAAIKCHLETLLNARQGCSQSSPELGLRDFNGH
DVSSGDLLQQVSADIRRTLQRFEPRIHVRALKAVPDCHAPLELHFRLDCQVQVNNQAEQL
QLELLVNGHNRYTRVR
NT seq 411 nt   +upstreamnt  +downstreamnt
atgagtggtttcttcgatcgcttgatggcggacccgtccgccatccgggaggcgtctcgc
caggaaagcgcttcgcacaagttcgcggccatcaagtgccacctcgaaacgttgctgaac
gctcgccaaggttgctcccagagcagccccgagctgggcctgcgcgacttcaacgggcat
gacgtcagcagcggcgacctgctgcagcaagtgagcgccgatatccgccgtaccctccag
cgctttgaaccgcgcatccacgtgcgcgcgctcaaagcggtaccggattgtcacgccccg
ttggaactgcatttcaggctcgactgccaggtgcaggtcaacaaccaggcagagcagttg
cagcttgagctgctggtaaacggacacaaccgctacacccgagtgaggtga

DBGET integrated database retrieval system