KEGG   Pseudomonas putida KT2440: PP_4124Help
Entry
PP_4124           CDS       T00114                                 

Gene name
nuoG
Definition
(RefSeq) NADH-quinone oxidoreductase subunit G
  KO
K00336  NADH-quinone oxidoreductase subunit G [EC:7.1.1.2]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00190  Oxidative phosphorylation
ppu01100  Metabolic pathways
Module
ppu_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PP_4124 (nuoG)
Enzymes [BR:ppu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Hydron translocation or charge separation linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     PP_4124 (nuoG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NADH-G_4Fe-4S_3 Molybdop_Fe4S4 Fer2_4 Molybdopterin Fer2 TPP_enzyme_M Fer4_6
Motif
Other DBs
NCBI-GeneID: 1042269
NCBI-ProteinID: NP_746243
UniProt: Q88FH2
Position
4661137..4663851
Genome map
AA seq 904 aa AA seqDB search
MATIHVDGKALEVNGADNLLQACLSLGLDIPYFCWHPALGSVGACRQCAVKQYTDENDTR
GRIVMSCMTPASDGTWISIDDEESKAFRASVVEWLMTNHPHDCPVCEEGGHCHLQDMTVM
TGHNERRYRFTKRTHQNQDLGPFIAHEMNRCIACYRCVRYYKDYAGGTDLGVYGAHDNVY
FGRVEDGVLESEFSGNLTEVCPTGVFTDKTHSERYNRKWDMQFAPSICHGCSSGCNISPG
ERYGELRRIENRFNGSVNQYFLCDRGRFGYGYVNRKDRPRQPQLADGTKLGLDAALDKAA
DLLRGRTIVGIGSPRASLESNYGLRELVGAEYFYSGMEAGELARVRLALNVLNNSPLPVP
TLRDIEDHDAVFVLGEDLTQTAARVALAVRQATKGKAEAMAEAMKVQPWLDAAVKNIGQH
ALYPLFIASLAETKLDDVAEECVHAAPADLARIGFAVAHAIDPSAPAVAGLDDEAQALAQ
RIADALVAAKRPLVVAGTSLADPALIEAAANIAKALKLREKNGSLSLVVPEANSLGLAML
GGESVDAALDAVISGKADAIVVLENDLYARVPAAKVDAALAAAKVVIVADHSKTATVDRA
HLVLPAASFAEGDGTLVSQEGRAQRFFQVFDPQYLDSSIQIHEGWRWMHALRATLLNKPV
DWTQLDHVTSACAEAAPQLAGIVNAAPSAAFRIKGMKLAREPLRYSGRTAMRANISVHEP
RTPQDKDTAFAFSMEGYSGSAEPRQQVPFAWSPGWNSPQAWNKFQDEVGGHLRAGDPGVR
LIESQGDRLNWFNAIPGAFNPARGIWTAVPFFHLFGSEESSSRAAPVQERIPAAYVALAK
SEADRLGVNDGALLSLNVAGVALRLPLRINEELGAGLVALPKGLAGIPPAIFGASVEGLQ
EAAQ
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atggccactatccacgtagacggcaaagcgctcgaagtcaacggtgcagacaacctgtta
caggcatgtctgtcgctcggcctcgacatcccttatttctgctggcacccggcgcttggt
agcgttggtgcctgccggcaatgcgcagtcaagcagtacaccgacgagaacgacacccgt
ggtcgtatcgtcatgtcctgcatgacccctgcttccgacggcacctggatttccatcgac
gatgaagagtcgaaggcgttccgcgccagcgtcgtcgaatggctgatgaccaaccacccg
cacgactgcccggtgtgcgaggaaggcggtcactgccacctgcaggacatgacggtaatg
accggccacaacgagcgccgctaccgtttcaccaagcgtacccaccagaaccaggacctc
ggcccgttcatcgcccatgagatgaaccgctgcatcgcctgctaccgctgcgtgcgctat
tacaaggactacgccggtggtaccgacctgggcgtctacggcgcccacgacaacgtgtac
ttcggccgcgtcgaagacggtgtgctggaaagcgagttctccggcaacctgaccgaggtc
tgcccgaccggcgtattcaccgacaagacccactccgaacgctacaaccgcaagtgggac
atgcagttcgccccaagcatctgccatggctgctccagcggctgcaacatcagcccgggt
gagcgctacggcgaactacgccgtatcgaaaaccgcttcaacggttcggtcaaccagtac
ttcctgtgcgaccgcggccgcttcggctacggctacgtcaaccgcaaggaccgcccacgc
cagccacaactggccgacggcaccaagctgggcctggacgccgccctggacaaggccgcc
gacctgctacgcggccgtaccatcgtcggtatcggctcgccacgcgccagcctcgaaagc
aactacggcctgcgtgagctggtcggcgccgagtacttctactcgggcatggaagctggc
gaactggcccgcgtacgcctggccctgaacgtgctgaacaacagcccgctgcccgtgccg
accctgcgcgacatcgaagaccacgacgccgtgttcgtgctcggtgaagacctgacccag
accgctgcccgcgttgccctggccgtgcgccaggccaccaaaggcaaggccgaggccatg
gccgaagccatgaaagtgcagccttggctcgacgctgccgtgaagaacattggccagcac
gcgctgtacccgctgttcatcgcatccctggctgaaaccaagctggacgacgtcgccgaa
gagtgcgtacacgccgcgccggccgacctggcccgcatcggtttcgccgtggcccacgcc
atcgacccgagcgcccctgccgtcgccggcctggacgacgaagcccaggccctggcccag
cgcatcgccgacgccctggtcgccgccaagcgcccactggtcgtagccggtacttcgctg
gccgacccggcgctgatcgaagcggctgccaacatcgccaaggccctgaagctgcgcgag
aaaaacggctcgctgagcctggtggtgcctgaggccaacagcctcggcctggccatgctc
ggtggcgagtcggtcgatgccgccctagacgcggtcatcagcggcaaagccgatgccatc
gtggtgctggaaaacgacctgtacgcccgcgtaccggccgccaaggtcgatgctgccctg
gctgcggccaaggtggtgatcgttgccgaccactccaaaaccgccaccgtcgaccgcgcc
cacctggtgctgccggccgcctcgttcgccgaaggcgacggtaccctggtcagccaggaa
ggccgtgcccagcgcttcttccaggtgttcgacccgcagtacctggacagcagcatccag
atccacgaaggctggcgctggatgcacgccctgcgtgccaccctgctgaacaagccggtc
gactggacccagctggaccacgtcaccagcgcctgcgccgaagccgctccgcaactggct
ggcatcgtcaacgccgcgccgagcgctgcgttccgcatcaagggcatgaagctggcccgt
gagccgctgcgctactccggccgtaccgccatgcgtgccaacatcagtgtgcacgagccg
cgcaccccgcaagacaaggacaccgcgttcgccttctccatggaaggctactcgggttcg
gccgaaccgcgccagcaggtgccattcgcctggtcgccgggctggaactccccacaagcc
tggaacaagtttcaggacgaggtcggtggccacctgcgtgccggtgacccaggcgtacgc
ctgatcgaatcgcaaggcgaccgcctgaactggttcaacgccattccgggggccttcaac
ccggcccgtggcatctggactgccgtgccgttcttccacctgttcggcagcgaagaaagc
tcctcgcgcgccgccccggttcaagaacgcatcccggctgcctacgtggccctagccaag
tccgaagccgaccgcctgggcgtcaacgacggcgccctgctgagcctgaacgtcgccggt
gtggccctgcgcctgccgctgcgtatcaatgaagagctgggcgctggcctggtcgcgctg
ccgaaaggcctggctggcattccgcctgccatcttcggtgcatccgtcgaaggtctgcag
gaggcagcacaatga

DBGET integrated database retrieval system