KEGG   Pseudomonas putida KT2440: PP_4346Help
Entry
PP_4346           CDS       T00114                                 

Gene name
ddlA
Definition
(RefSeq) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00473  D-Alanine metabolism
ppu00550  Peptidoglycan biosynthesis
ppu01100  Metabolic pathways
ppu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PP_4346 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PP_4346 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PP_4346 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppu01011]
    PP_4346 (ddlA)
Enzymes [BR:ppu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PP_4346 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ppu01011]
 Precursor biosynthesis
  Amino acid ligase
   PP_4346 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-GeneID: 1042642
NCBI-ProteinID: NP_746461
UniProt: Q88EV6
Position
complement(4937694..4938752)
Genome map
AA seq 352 aa AA seqDB search
MKQNVIALVFGGRSSEHSVALRSAATIHAALMALGHRVHCVGIDREGNWRYQGEPCQFPG
AVDRSAPLISIRPGHRSLSYTTQESGTVEIGIDLLFPALHGRWGEDGTIQGLAAMCGLPC
VGSGVLGSAMAMDKDVTKRMVQSAGLVVVPWLAMNSMRPWEELVECLGSSTLFVKPATSG
SSIGVSRVSNALEYAAAFAIAAREDTKVLVEAAVCGREIECGVLELEEGLMASVVGEIIK
KEGHAYYDYQAKYDSNSVTGLRVPSLLPPDIVARIQALSVQAFRCLELKGYARVDFFLTE
EGEIILNEINTLPGFTSASMYPKMFECSGYPPPKLVGALVEYGLSSASKERL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaatgtgatcgcactggtttttggggggcggagctcagagcattcagtggcg
ctacgctccgccgctacaatccacgcggcgctgatggctctcggtcacagggtgcactgt
gtagggatagatcgtgagggcaactggaggtatcaaggagagccgtgccagttccctggt
gcggttgatcggtcggctccgttgatttcaattcgtccaggccatcgctcgctctcatac
acaactcaagagagcggcacggtggagattgggatcgatttgcttttcccggcactgcat
ggtcggtggggggaggatggaacaattcaaggattggcagcgatgtgcggtttgccgtgt
gtgggctccggggtgctaggttcggcaatggccatggataaagatgtcacaaagagaatg
gtccagtctgccgggcttgttgtggtgccttggctggccatgaactccatgcgtccttgg
gaggaactggttgagtgcctgggtagcagcacgctcttcgtaaagcccgctacttcgggc
tcatcgattggtgtgtctagggtctccaacgccttggaatatgctgcggcatttgctatt
gcagcacgagaggacacaaaggtgctggtggaggctgctgtctgtggaagagagatagag
tgtggtgtgctcgaacttgaggagggtttgatggcctcggtggtgggtgaaataatcaaa
aaggaagggcacgcctattacgattatcaggcgaaatacgattccaacagtgtgacaggt
cttcgtgtgccaagcttgttgccacctgacattgtcgcgcgcatccaggctttatctgtc
caggcgtttagatgccttgaactgaaggggtacgccagggtggattttttcttgacagaa
gagggtgaaattattctcaatgagatcaataccttacccggatttacgagtgccagtatg
tacccgaagatgtttgagtgctccggttaccctccgccgaagttggtaggagcgctagtc
gaatatgggctctcatcagcatctaaagaacgtttatga

DBGET integrated database retrieval system