KEGG   Pseudomonas putida KT2440: PP_5351Help
Entry
PP_5351           CDS       T00114                                 

Gene name
zwf
Definition
(RefSeq) glucose 6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00030  Pentose phosphate pathway
ppu00480  Glutathione metabolism
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01120  Microbial metabolism in diverse environments
ppu01130  Biosynthesis of antibiotics
ppu01200  Carbon metabolism
Module
ppu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ppu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ppu_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PP_5351 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PP_5351 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppu04147]
    PP_5351 (zwf)
Enzymes [BR:ppu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     PP_5351 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     PP_5351 (zwf)
Exosome [BR:ppu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PP_5351 (zwf)
  Exosomal proteins of colorectal cancer cells
   PP_5351 (zwf)
  Exosomal proteins of bladder cancer cells
   PP_5351 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 1042114
NCBI-ProteinID: NP_747452
UniProt: Q88C32
Position
6099177..6100634
Genome map
AA seq 485 aa AA seqDB search
MESGGLTIPCDILVFGGTGDLALHKLLPALYHLFREARLNPAVRVIALARRNLPRIDYLK
LAERHCRAQIARSDFDEEVWQRFSARVDYFPMDASQSADFGRLARYLGEPGGLTRIFYLA
TAPNLFVPIANHLRIAGLADTEARIVLEKPIGHSLESATAINEAIGTVFEERQVFRIDHY
LGKETVQNLMALRFANALLEPVWRNNQVDHVQISVCETLGVENRGAYYDRAGAIRDMLQN
HLLQLLCLVAMEPPAQFEAEAVRDEKVKILRALKPITGQDVQDKTVRGQYGAGRIGGQEV
PAYYFEKDVDNDSDTETFVAIEAHIDNWRWAGVPFYLRTGKRMARRASQIVIQFKPVPHE
LFSGGQVNQLLIQLQPDERISLRMMTKSPGKGMRLEPVDLDLNLAQVFSQTRRWEAYERL
LLDVLEGDSTLFMRRDEVEAAWAWVDPIIKGCEEHFQAPRPYPAGSFGPEQANSLLARHG
RHWHG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtggagagtggtggtttgactattccttgcgacattctggtcttcggcggcaccggtgat
ctggccctgcacaaattgcttccggcgctctaccacctgtttcgcgaggcccgtctgaac
cctgccgtgcgggtcatcgcactggccaggcgcaacctgccacgcatcgactatctgaag
ctcgccgaacgccattgtcgggcgcagattgcccgcagcgacttcgacgaagaggtgtgg
cagcggttttccgcacgggtcgactacttcccgatggatgcttcacagagcgccgacttc
ggccgcctggcacgctacctgggcgaacccggtggactgacacgcatcttctacctggcc
accgctcccaacctgttcgtgccgattgccaaccacctgcgcattgccggactggccgac
accgaagcgcgcatcgtgctggaaaaaccgatcggccattcgctggaatcggccactgcc
atcaatgaagcgattggcacggtgttcgaagaaagacaggtgttccgcatcgaccactac
ctgggcaaggaaaccgtgcagaacctgatggccctgcgttttgccaatgccctgctggag
ccggtgtggcgcaacaaccaggtcgaccatgtccagatcagcgtttgcgagacactgggc
gtagaaaaccgcggtgcctactacgatcgcgccggggctattcgcgacatgctgcagaac
cacctgctgcagctgctgtgcctggtggccatggagccacccgcgcaattcgaggcagag
gcggtacgcgacgaaaaggtgaaaatcctgcgcgccctcaagccgatcaccggccaggat
gtgcaggacaagacggtacgcggccaatatggggccgggcgtatcggcggccaggaagtg
ccggcctactactttgaaaaggacgtcgacaacgacagcgataccgaaactttcgtggcc
atcgaggcgcatatcgacaactggcgctgggcgggcgtgcctttctatctgcgcaccggc
aaacgcatggcgcggcgcgcttcgcagatcgtcatccagttcaagccagtgcctcacgaa
ctgttcagcggcggccaggtcaaccagttgctgatacagctgcaaccggacgaacgcatc
agcctgcgcatgatgaccaagagcccaggcaagggcatgcgcctggaacccgtggacctg
gaccttaatctggcccaggtgttcagccagactcgccgctgggaagcctacgagcgtctg
ctgctggatgtgctcgaaggtgattcgacactgttcatgcgccgcgatgaagtggaagca
gcctgggcttgggtagatccaatcatcaagggctgtgaagagcacttccaggcgccccgc
ccctacccggctggcagtttcgggcccgaacaagccaacagcctgctcgccaggcatggc
aggcactggcatggctga

DBGET integrated database retrieval system