KEGG   Pseudomonas putida KT2440: PP_5389
Entry
PP_5389           CDS       T00114                                 

Definition
(RefSeq) hypothetical protein
Organism
ppu  Pseudomonas putida KT2440
SSDB
Motif
Pfam: ICMT PEMT DUF1295
Other DBs
NCBI-GeneID: 1042037
NCBI-ProteinID: NP_747490
UniProt: Q88BZ4
Position
complement(6144780..6145439)
AA seq 219 aa
MNHGESAYGLWSLVFINSAIFIMFAFSFFKPATARDWRSFGAFSAFIVALFVEMYGFPLT
IYLLSGWLQARFPNLDLLSHESGHLWSTLLGDQGNPHFSVLHIASYLFLGFGFYLLSAAW
NVLYHAQRRHSLATVGPYGWIRHPQYVAFVLILLGFLLQWPTLLTLAMFPVLLVMYGRLA
VSEEREMHKQFGAAYEAYTRVTPRFVPHLRERLGGGHRG
NT seq 660 nt   +upstreamnt  +downstreamnt
atgaatcatggtgaaagcgcgtatggcctctggtcgctggttttcatcaactccgcgatc
ttcatcatgtttgccttcagtttcttcaagccggcaacggcgagagactggaggagcttc
ggtgccttctcggcgttcatcgttgccctgtttgtggaaatgtatggcttccccctgacg
atctatctgttgtcaggctggttgcaggccaggttccccaacctcgatctgctttcccac
gaatccggccatctgtggtcgacgttgctcggtgaccagggcaacccacacttcagtgtt
ttgcacattgccagctacctattcctgggtttcggcttctatttgctttctgccgcctgg
aacgtgctatatcacgcgcaacgccgccattcacttgcaacggtcgggccctatggctgg
atcagacatccgcagtacgtggcatttgtgctgattcttctgggttttctccttcagtgg
ccgacgctgctgacgcttgcaatgttcccggtgttgctggtgatgtacgggcgtttggcg
gtttccgaagagcgggaaatgcacaagcagtttggcgctgcctacgaagcttatacccgc
gttacgcctaggttcgttccgcacctgcgcgaaagattgggtgggggtcatagaggctaa

DBGET integrated database retrieval system