KEGG   Pseudomonas putida KT2440: PP_5576
Entry
PP_5576           CDS       T00114                                 
Name
(GenBank) conserved protein of unknown function
Organism
ppu  Pseudomonas putida KT2440
SSDB
Other DBs
NCBI-ProteinID: AMM02910
UniProt: A0A140FWC7
Position
3515484..3515960
AA seq 158 aa
MVINGGSLAENLVGSSAYRELLAELVDATGIEVESEYAEVFARLDSAKIVKAKVDIDDLM
SILTNKMDLIKQYSICKFQALSDEEDEEEYPVGAEPSGDERSKTLSVGKYSQGFLLTNLI
EFALAMSGRECLLEYIKLCRIPNAKKYTDQIIKLTGLG
NT seq 477 nt   +upstreamnt  +downstreamnt
atggtaatcaatggcggttcattggcggagaatctagttgggtcgtctgcttatagggag
ttacttgcggagctagtcgacgctacaggtattgaggttgagtcggaatatgcagaagta
ttcgctcgtctcgactctgctaagattgtaaaggcaaaggttgatattgatgacttgatg
tccatattgacaaacaaaatggatcttataaagcagtattctatttgtaagttccaagcg
ctttcagatgaggaggatgaggaagagtatcccgttggcgcagagccttctggcgatgaa
agaagtaaaactctttcggttgggaaatattcacaaggttttttgttgaccaatcttatt
gagtttgcattggcgatgtctggtcgtgaatgcctgctggaatatattaaattgtgtaga
atcccaaatgcaaaaaaatatactgatcaaataatcaagttgacaggtcttgggtag

DBGET integrated database retrieval system