KEGG   Pseudomonas putida DLL-E4: DW66_0325Help
Entry
DW66_0325         CDS       T03439                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00260  Glycine, serine and threonine metabolism
ppud01100  Metabolic pathways
ppud01110  Biosynthesis of secondary metabolites
ppud01120  Microbial metabolism in diverse environments
ppud01130  Biosynthesis of antibiotics
ppud01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DW66_0325
Enzymes [BR:ppud01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DW66_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHZ74851
UniProt: A0A059UPZ0
Structure
PDB: 

Position
complement(352771..353811)
Genome map
AA seq 346 aa AA seqDB search
MTDKSQQFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERAAEYFRKLFETDCEVFF
AFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLTAPSVNGKLTPQ
SIREVALKRQDIHYPKPRVVTITQATEVGTVYRPDELKAISATCKELGLNLHMDGARFSN
ACSFLGCSPAELTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASK
MRFLSAPWVGLLEDGAWLRHGAHANHCAQLLASLVSDLPGVDLMFPVEANGVFLQMPEHA
IEALRSRGWRFYTFIGSGGARFMCSWDTEEERVRELAADIRAIIGA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacagataagagccaacaattcgccagcgacaactattccggcatctgccccgaagcc
tgggcagcgatggaaaaggccaaccatggccacgaccgcgcctacggcgacgaccagtgg
accgaacgcgccgcggaatacttccgcaagctgttcgaaaccgactgcgaggtgttcttc
gccttcaacggcaccgccgccaactccctggcgctggcctcgctgtgccagagctaccac
agcgtgatctgctccgagaccgcccacgtcgaaaccgacgagtgcggtgcgccggagttc
ttctccaacggctccaagctgctgaccgcgcccagcgtcaacggcaagctgacaccacag
tcgatccgcgaagtggcgctgaagcgtcaggacatccactaccccaagccacgggtggtg
accattacccaggccaccgaggtgggcaccgtctatcgccccgacgagctgaaggcgatc
agcgccacctgcaaagagctggggctgaacctgcacatggacggcgcacgcttcagcaat
gcctgctcgttcctgggctgcagcccggcagagctgacctggaaggccggtgtcgatgta
ctgtgctttggcggcaccaagaacggcatggcggtgggcgaggcgatcctgttcttcaac
cgccaactggccgaggacttcgactaccgctgcaagcaggccgggcaactggcatcgaag
atgcgcttcctgtcggcgccttgggtgggcctgctggaagatggcgcctggttgcgccat
ggcgcgcatgccaaccattgcgcgcagttgctcgcctcgctggtgagtgatttgccggga
gtggatctgatgttcccggttgaggccaacggggtgttcctgcagatgccggagcatgcg
atcgaggcactgcgcagcaggggatggcggttctataccttcattggtagcggcggggcg
cggttcatgtgctcgtgggataccgaggaagagcgggtgcgcgagctggcggcggatatc
cgcgccatcatcggcgcctga

DBGET integrated database retrieval system