KEGG   Pseudomonas putida DLL-E4: DW66_0533Help
Entry
DW66_0533         CDS       T03439                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00740  Riboflavin metabolism
ppud00790  Folate biosynthesis
ppud01100  Metabolic pathways
ppud01110  Biosynthesis of secondary metabolites
ppud02024  Quorum sensing
Module
ppud_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    DW66_0533
   00790 Folate biosynthesis
    DW66_0533
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DW66_0533
Enzymes [BR:ppud01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     DW66_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AHZ75057
UniProt: A0A059URC3
Position
582872..583432
Genome map
AA seq 186 aa AA seqDB search
MHGFLDEATGREHVVLSLGDIADGQPVLGRLHSECLTGDALFSQRCDCGSQLEAALQAIA
REGRGVLLYLRQEGRGIGLLNKIRAYELQDGGADTVEANERLGFAADQRDYAMCLPMLEH
LGVKSLRLMTNNPRKVKALTDMNIVVAERVPLHTGHNPHNRYYLATKAGKLGHMLGNEHQ
GEVPQA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcatggcttcctcgacgaagccactggccgtgagcacgtggtgctcagcctgggtgac
atcgcggacggccagccggtgctggggcgcctgcactccgagtgcctgaccggcgatgcc
ctgttcagccagcgctgcgactgcggctcgcagctggaagccgcgctgcaggccatcgcc
cgtgaaggccgtggcgtgctgctgtacctgcgccaggaaggccgtggcatcggcctgctg
aacaagattcgcgcctacgagctgcaggacggtggcgccgataccgtcgaggccaacgag
cgcctgggcttcgccgccgaccagcgcgactacgccatgtgcctgccgatgctggagcac
ctgggcgtgaagtcgctgcgcctgatgaccaacaacccgcgcaaggtcaaagccctgacc
gacatgaacatcgtcgtcgccgagcgcgtaccgctgcacaccgggcacaacccgcacaac
cgctactacctggcaaccaaggccggcaagctgggccacatgctgggtaacgagcaccag
ggcgaggtgcctcaggcgtga

DBGET integrated database retrieval system