KEGG   Pseudomonas putida DLL-E4: DW66_0566Help
Entry
DW66_0566         CDS       T03439                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DW66_0566
Enzymes [BR:ppud01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DW66_0566
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DW66_0566
    1.1.1.-  
     DW66_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 DAO PALP UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AHZ75090
UniProt: A0A059US65
Position
complement(613603..614184)
Genome map
AA seq 193 aa AA seqDB search
MHAVKKAGSLLGETVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSSARKAKAKEVGASVV
LDPSQCDALVEIRKLTAGLGADVSFECIGNKHTAKLAIDTIRKAGKCVLVGIFEEPSEFN
FFELVSTEKQVLGALAYNGEFADVIAFIADGRLDIGPLVTGRIGLEQIVELGFEELVNNK
EENVKIIVSPGVR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcggtaaagaaggccggcagcctgcttggcgagacggtggtggtagttggagcc
ggcactatcggtttgtgcaccatcatgtgtgccaaggcggcaggcgcggcgcaggtgatc
gccctggaaatgtcctcggcacgcaaggccaaggccaaagaggttggcgccagcgtggtg
ctggaccccagccagtgcgacgccctggtggaaatccgcaagctcactgccgggctgggc
gcggatgtgagttttgaatgcatcggcaacaagcacacggccaagctggccatcgacacc
atccgcaaggcgggcaagtgcgtgttggtggggatattcgaggagcctagcgagttcaac
ttcttcgaactggtgtccaccgaaaagcaggtgctgggcgcgttggcgtacaacggcgag
tttgccgatgtgattgccttcatcgctgacggcaggctggacattggcccgctggtgacc
gggcggatcgggctggagcagattgtcgagctgggcttcgaggagttggtcaacaacaag
gaggagaacgtgaagatcatcgtttcgccgggcgtgcgctga

DBGET integrated database retrieval system