KEGG   Pseudomonas putida DLL-E4: DW66_0599Help
Entry
DW66_0599         CDS       T03439                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00071  Fatty acid degradation
ppud00072  Synthesis and degradation of ketone bodies
ppud00280  Valine, leucine and isoleucine degradation
ppud00310  Lysine degradation
ppud00362  Benzoate degradation
ppud00380  Tryptophan metabolism
ppud00620  Pyruvate metabolism
ppud00630  Glyoxylate and dicarboxylate metabolism
ppud00640  Propanoate metabolism
ppud00650  Butanoate metabolism
ppud00900  Terpenoid backbone biosynthesis
ppud01100  Metabolic pathways
ppud01110  Biosynthesis of secondary metabolites
ppud01120  Microbial metabolism in diverse environments
ppud01130  Biosynthesis of antibiotics
ppud01200  Carbon metabolism
ppud01212  Fatty acid metabolism
ppud02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DW66_0599
   00630 Glyoxylate and dicarboxylate metabolism
    DW66_0599
   00640 Propanoate metabolism
    DW66_0599
   00650 Butanoate metabolism
    DW66_0599
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DW66_0599
   00072 Synthesis and degradation of ketone bodies
    DW66_0599
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DW66_0599
   00310 Lysine degradation
    DW66_0599
   00380 Tryptophan metabolism
    DW66_0599
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DW66_0599
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DW66_0599
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DW66_0599
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppud04147]
    DW66_0599
Enzymes [BR:ppud01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DW66_0599
Exosome [BR:ppud04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DW66_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHZ75122
UniProt: A0A059URG0
Position
652313..653590
Genome map
AA seq 425 aa AA seqDB search
MRSLRRVAILGGNRIPFARSNGAYATASNQAMLTVALEGLIERYRLHGLRMGEVVAGAVL
KHSRDMNLTRECVLGSRLSPLTPAYDIQQACGTGLEAALLVANKIALGQIDCGIAGGVDT
TSDAPIAVNEGLRHILLQANRGKSLGERLKPFLKLRPHHLKPELPRNGEPRTGLSMGEHC
ERMAQAWRIGRAEQDELALLSHQALAAAYAEGWQDDLLTPFLSLTRDNNLRPDLTLEQLA
KLKPAFDRSGQGTLTAGNSTPLTDGASLVLLGSEEWAEQQGLSVLAYLVDGETAAVDFVT
GREGLLMAPVYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLKAWEDADYCRERLGLD
APLGAIDRSKLNVKGSSLAAGHPFAATGGRILANLAKLLARSGKGRGLISICAAGGQGVT
VIVER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcacttcgccgggtcgcgatcctgggcggcaaccgaattcccttcgcccgttcc
aatggcgcctacgccacggccagcaaccaggcgatgctaaccgtcgccctcgaagggctg
atcgaacgctaccgcctgcatgggttgcgcatgggggaggtggtggctggcgctgtgctc
aagcactcgcgagacatgaacctgacacgtgagtgcgtgctgggttcgcgcctgtcgccg
ctgacgccagcctatgacatccagcaagcctgcgggacggggctagaggcggcactgctg
gtggccaacaagattgccctggggcagatcgactgcggcatagccggcggtgtggacacc
acctccgatgcgccgattgcggtcaacgaaggcctgcgccacatcctgttgcaggccaac
cgtggcaagagcctgggcgaacggctcaagccatttctcaagctgcgtcctcaccacctg
aaacccgaattaccgcgcaacggtgagccgcgcaccggtttgtctatgggcgagcattgc
gaacgcatggcccaggcctggcgcattggccgtgccgagcaggacgagctggcgctgctg
agccaccaggcgctggctgccgcgtacgccgaagggtggcaggatgacctgctgacgccg
tttctgtctttgacccgtgataacaacctgcgccccgacctgacgctggaacaattggcc
aagctcaagccagccttcgaccgcagcgggcagggcacgctgacggcgggcaactccaca
ccgctgaccgatggtgcttcgctggtgttgctgggcagcgaggaatgggccgagcagcag
gggctgtcggtgctggcctatctggtcgatggtgaaaccgctgcggtggatttcgttact
ggtcgcgaagggctgttgatggcgccggtgtatgcggtgccgcggctgttggcgcgcaat
ggcctgacgctgcaggactttgactattacgagattcacgaagcctttgctgcccaggtg
ctgtgcacgctcaaggcctgggaagatgccgattattgccgcgaacggctggggctggat
gcgccgctcggggcgattgaccgcagcaagctcaacgtcaagggcagttcgctggcggcc
gggcacccgtttgccgcgaccggggggcggatattggccaacctggccaagctgctggcg
aggtcggggaaggggcgggggttgatatcgatctgcgctgcgggtgggcagggggtgacc
gtcatcgtcgagcgctga

DBGET integrated database retrieval system