KEGG   Pseudomonas putida DLL-E4: DW66_0622
Entry
DW66_0622         CDS       T03439                                 

Definition
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DW66_0622
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppud01007]
    DW66_0622
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ppud03016]
    DW66_0622
Enzymes [BR:ppud01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     DW66_0622
Amino acid related enzymes [BR:ppud01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DW66_0622
Transfer RNA biogenesis [BR:ppud03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DW66_0622
 Prokaryotic type
   Other AARSs
    DW66_0622
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e tRNA-synt_1_2 zf-FPG_IleRS tRNA-synt_1f
Other DBs
NCBI-ProteinID: AHZ75145
UniProt: A0A059USA0
Position
683052..685883
AA seq 943 aa
MTDYKATLNLPDTAFPMKAGLPQREPQILQRWDSIGLYQKLREIGKDRPKFVLHDGPPYA
NGKIHIGHALNKILKDMIVRSKTLAGFDAPYVPGWDCHGLPIEHKVEVTHGKHLSADRTR
ELCREYAAEQIEGQKTEFIRLGVLGDWDNPYKTMNFANEAGEIRALAEMVKQGFVFKGLK
PVNWCFDCGSALAEAEVEYADKKSQTIDVAFPVADDAKLAAAFGLASLAKPAAIVIWTTT
PWTIPANQALNIHPEFKYALVDTGERLLVLAEELVESCLKRYSLEGSVIATAQGSALELI
NFRHPFYDRLSPIYLADYVELGAGTGVVHSSPAYGEDDFVTCKRYGMVNDDILTPVQSNG
VYVDSLPFFGGQFIWKANPAIVEKLSEVGALMHTETISHSYMHCWRHKTPLIYRATAQWF
VGMDKQPTTGEPLRERALKAIEDTKFVPAWGQARLHSMIANRPDWCISRQRNWGVPIPFF
LHKQTGELHPRTVELMEAVAKRVEQEGIEAWFKLDAAELLGAEAEQYDKITDTLDVWFDS
GTTHWHVLRGSHDIGHATGPRADLYLEGSDQHRGWFHSSLLTGCAIDGHAPYRELLTHGF
TVDENGRKMSKSLGNTIEPEKVNNTLGADILRLWVAATDYSGEMAVSEQILQRSADAYRR
IRNTARFLLSNLSGFDPARDLLAPEDMLALDRWAVDRTLLLQRELEEHYSEYRFWNVYSK
VHNFCVQELGGFYLDIIKDRQYTTGANSVARRSCQTALYHISEALVRWIAPILAFTADEI
WQYLPGERNESVMLNGWYEGLSELPVGTELDRAYWDRVMAVKASVNKELENQRTAKVIGG
NLQAEVTLYADEGLSADLGKLGDELRFVLITSAASVVPFAQAPAEAVATEVEGLKLQVVK
SGHTKCGRCWHFRADVGSHPEHPEICGRCVDNLSGSGEVRHYA
NT seq 2832 nt   +upstreamnt  +downstreamnt
atgaccgactacaaagccacgcttaaccttccggacaccgccttccccatgaaggccggc
ctgcctcagcgcgaaccgcagatcctgcagcgctgggacagcattggcctgtaccagaag
ctgcgcgaaattggcaaggatcgtcccaagttcgtcctgcacgacggcccgccctatgcc
aacggcaagattcacatcggtcatgcgctgaacaagatcctcaaggacatgatcgtccgt
tccaagaccctggccggcttcgatgcgccgtatgtgccgggctgggactgccatggcctg
ccgatcgagcacaaggtcgaggtcacccacggcaagcatctgtccgccgaccgcactcgc
gagctgtgccgcgagtacgccgccgagcagatcgaagggcagaagaccgagttcatccgc
ctgggcgtgctgggtgactgggacaacccgtacaagaccatgaactttgccaacgaggcc
ggcgaaatccgcgccctggccgagatggtcaagcaaggcttcgtgttcaagggcctgaag
cctgtgaactggtgcttcgattgcggttcggccctggccgaggccgaagtcgagtacgcc
gacaagaaatcgcagaccatcgacgttgccttcccggtagccgatgacgccaagctggct
gctgccttcggtctggcttcgctggccaagccggctgccatcgtgatctggaccaccacc
ccgtggactatcccggccaaccaggcgctgaacatccacccggagttcaagtacgccctg
gtcgacaccggcgagcgtctgctggttctggccgaagagttggtcgagtcgtgcctcaag
cgctacagcctggaaggctcggtcattgccaccgcccagggttcggcactggaactgatc
aacttccgccacccgttctatgaccgcctgtcgccaatctacctggctgactacgtcgaa
ctgggcgccggtaccggcgtggtgcactcctcgccagcctacggtgaagacgacttcgtc
acctgcaagcgctacggcatggtcaacgacgacatcctcaccccggtgcagagcaacggc
gtgtatgtggactcgctgccattcttcggcggccagttcatctggaaggccaacccggcc
atcgtcgagaagctgagcgaagtcggcgcgctgatgcacaccgaaaccatcagccacagc
tacatgcactgctggcgccacaagaccccgctgatctaccgcgccaccgcgcagtggttc
gtgggtatggacaagcagccgaccaccggcgagccgctgcgtgagcgcgcacttaaagcc
atcgaagacaccaagttcgtcccggcctggggccaggcgcgcctgcattcgatgatcgcc
aaccgcccggactggtgcatctcccgtcagcgcaactggggtgtaccgatcccgttcttc
ctgcacaagcagaccggcgagctgcacccacgcaccgtcgagctgatggaagcagtggcc
aagcgcgtcgaacaggaaggcatcgaggcctggttcaagctggacgccgccgaactgctg
ggcgctgaagccgagcagtacgacaagatcaccgacaccctcgacgtgtggttcgactcg
ggtaccacccactggcacgtgctgcgtggctcgcatgacattggccacgccaccggcccg
cgtgccgacctgtacctggaaggttccgaccagcaccgcggctggttccactcgtccttg
ctgaccggttgcgccatcgacggccacgcgccgtaccgcgagcttctgacccacggcttc
accgtggacgagaacggccgcaagatgtccaagtcgctgggcaacaccatcgagccagaa
aaggtcaacaacaccctgggtgccgatatcctgcgcctgtgggttgccgctaccgactat
tccggtgaaatggccgtttccgagcaaatcctgcagcgcagcgccgacgcctaccgccgt
atccgcaacactgcacgcttcctgctctccaacctgtccggcttcgacccggcccgcgat
ttgctggccccggaagacatgctggcgctggaccgctgggcggttgaccgcaccctgctg
ctgcaacgcgagctggaagagcactacagcgagtaccgtttctggaacgtctactccaag
gtgcacaacttctgcgtgcaggaactgggcggcttctacctcgacatcatcaaggaccgc
cagtacaccaccggcgccaacagtgtcgctcgccgttcctgccagaccgcgctctaccac
atcagcgaggcgctggtgcgctggatcgcgccgatcctggcgtttacggccgacgaaatc
tggcagtacctgccaggcgagcgcaacgagtcggtaatgctcaacggctggtacgaaggc
ctgagcgagctgccggtaggtaccgaactggaccgcgcctactgggaccgcgtgatggcc
gtcaaggcatcggtcaacaaggagctggaaaaccagcgtaccgccaaggtcatcggcggc
aacctgcaggccgaagtcaccctgtacgccgacgaaggcctgagcgccgacctgggcaag
ctgggcgacgaactgcgcttcgtgctgatcacctcggctgccagcgtggtgccattcgcg
caagcgccggccgaagcggtggccaccgaagtcgaaggcctcaagctgcaagtggtcaag
tccggccacaccaagtgcggccgttgctggcacttccgcgccgacgtcggcagccacccg
gagcacccggaaatctgcggccgttgcgtcgacaacctgagcggttccggcgaggtgcgc
cactatgcctaa

DBGET integrated database retrieval system