KEGG   Pseudomonas putida DLL-E4: DW66_0795Help
Entry
DW66_0795         CDS       T03439                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00480  Glutathione metabolism
ppud00590  Arachidonic acid metabolism
ppud01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    DW66_0795
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DW66_0795
Enzymes [BR:ppud01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DW66_0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like
Motif
Other DBs
NCBI-ProteinID: AHZ75318
UniProt: A0A059UW11
Position
878307..878789
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLKLDALNGGELPLAPFKGQVVLVVNVASKCGLTPQYKALENLYQNYKDKGFNVL
GLPCNQFAGQEPGSEKEIQEFCSLNYGVSFPLGAKLEVNGPQRHSLYRLLAGEGAEFPGD
ITWNFEKFLVGKDGRVLARFSPRTAPDDPAVVQAIEKALA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatttcacgacctgaaactggacgcattgaacggcggggagctgcccctcgca
ccgttcaagggccaagtggtgctggtggtcaacgttgcctccaagtgtggcctcacgccg
caatacaaggccctggagaacctctaccagaattacaaggacaagggcttcaacgtgctt
ggccttccgtgcaaccagtttgccgggcaggagcctggcagcgaaaaggaaattcaggag
ttctgcagcctcaactacggggtgagcttcccgctgggtgccaagctggaggtcaacggg
ccgcagcgccattcgctgtaccgactgctggcgggtgagggggcggagttcccgggcgac
attacctggaacttcgagaagttcctggtgggcaaggacgggcgggtgctggcgcgtttt
tcgccgcgcacggcgccggatgatcctgcggtggtgcaggctatcgagaaagccttggcc
tga

DBGET integrated database retrieval system