KEGG   Pseudomonas putida DLL-E4: DW66_1253Help
Entry
DW66_1253         CDS       T03439                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00860  Porphyrin and chlorophyll metabolism
ppud01100  Metabolic pathways
Module
ppud_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DW66_1253
Enzymes [BR:ppud01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     DW66_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AHZ75773
UniProt: A0A059UXB1
Position
1365316..1365882
Genome map
AA seq 188 aa AA seqDB search
MILDLLRHGETEQGGLRGSLDDALTDKGWAQMRQAVAEAGPWEVLVSSPLQRCACFAEEL
GERLNLPVQREAALQELHFGDWEGRSAAQIMEDQADALGRFWADPYAFTPPNGEPVEAFA
ERVLAAVERLSQQHAGKRVLLVTHGGVMRLLLARARGLPRAQLLQVEVGHAALMRLVPGD
DGQWVEGR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgacctgctgcgccatggcgaaacggaacagggcggcctgcgtggcagcctt
gatgatgccttgaccgacaagggctgggcgcagatgcgtcaagccgtggccgaagccggc
ccgtgggaggtgctggtcagttcgccgctgcagcgctgtgcgtgttttgccgaggaactg
ggcgagcggctgaacctgcctgtgcagcgcgaagcggcattgcaggagctgcattttggc
gactgggagggccgtagtgcggcgcagatcatggaagaccaggcggacgcgctggggcgc
ttctgggcggacccttacgcgtttacaccgcccaatggcgagccggtcgaggcgttcgcc
gagcgtgtgctggcggctgtcgagcgcctgagccagcagcatgctggcaagcgtgtgctg
ctggtcacccatggcggcgtgatgcggctgctgctggcccgtgcccgtggtttgccaagg
gcgcagttgctgcaggtcgaagtcggccacgctgcgctcatgcgattggtgccgggtgac
gacggccagtgggtcgaggggcgctga

DBGET integrated database retrieval system