KEGG   Pseudomonas putida DLL-E4: DW66_1977Help
Entry
DW66_1977         CDS       T03439                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00020  Citrate cycle (TCA cycle)
ppud00620  Pyruvate metabolism
ppud01100  Metabolic pathways
ppud01110  Biosynthesis of secondary metabolites
ppud01120  Microbial metabolism in diverse environments
ppud01130  Biosynthesis of antibiotics
ppud01200  Carbon metabolism
Module
ppud_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppud_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DW66_1977
   00620 Pyruvate metabolism
    DW66_1977
Enzymes [BR:ppud01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     DW66_1977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_oxidored DUF3768
Motif
Other DBs
NCBI-ProteinID: AHZ76495
UniProt: A0A059UVA6
Position
2153840..2155414
Genome map
AA seq 524 aa AA seqDB search
MKKFLLTFLCLGVIGCSKPAEPEKTVDVLLIGGGIMSASLGTYLTELEPSWKIDVYERLD
QVAEESSNAWNNAGTGHSAFCELNYTSVGKDGNIDISKAVGVNEQFEVSKQFWAYQVEQG
VLSNPKSFINNVPHMSFVWGDDNVAFLHKRVDALQHSSLFRGMEISEDHEQIRKWAPLVM
EGRDPGQKVAATRMAIGTDVNFGEITRQLFAAMTRNPNVSLNLRHEVRDIVRNDDGTWHV
RVLDLANGGEEKAVNARFVFIGAGGGALKLLQKSGIPEAEGYAGFPVGGQFLMTDNPDLV
ARHQAKLYGKASVGAPPMSVPHLDTRMIDGKQVLLFGPFATFSTKYLKHGSLLDMFASLN
SHNVLPMVNAGIDNIDLSTYLMGQLMLSFDDRMNALREYFPNAKNEDWKLLQAGQRVQVI
KKDPVLGGVLQFGTEVVAAQDGSIAALLGASPGASTAAPIMLTVLEKTFKDRIQSPAWQA
RLKEIVPSYGQKLNNNLALTNQTRAWSSERLQLLYVPVEAEVSH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattcctgctgacgttcctctgcctgggcgtcatcggctgctccaaacccgcg
gaaccggaaaagaccgtcgacgtgctgctgatcggcggtggcatcatgagtgccagcctg
ggtacctacctcaccgagctggagccctcctggaagatcgacgtctatgagcgcctggac
caggtggccgaagaaagctccaatgcctggaacaacgccggcaccggtcactccgcgttc
tgcgagttgaactacaccagtgtgggcaaggacggcaatatcgatatcagcaaggccgtt
ggggtcaacgagcagttcgaggtgtccaagcagttctgggcctaccaggtcgagcagggc
gtgctgagcaacccgaagtcgttcatcaacaacgtgccgcacatgagttttgtctggggt
gacgacaacgtcgccttcctgcacaagcgcgtcgacgccctgcagcacagctcgctgttc
cgcggcatggaaatctcggaagaccacgagcagatccgcaagtgggcgccgctggtgatg
gagggccgtgacccggggcagaaggtcgccgccacgcgcatggccatcggtaccgacgtg
aactttggcgaaatcacccgccagttgttcgccgcgatgacccgcaaccccaatgtgtcg
ctgaacctgcgtcatgaggtgcgtgacatcgtgcgcaacgacgacggcacctggcatgtg
cgggtgctcgatctggccaacggcggcgaggaaaaggccgtcaacgcccgcttcgtgttc
atcggtgccggtggtggcgcgctgaagctgctgcagaagtcgggcattcctgaagccgaa
ggctacgccggcttcccggtcggtggtcagttcctgatgaccgacaaccccgacctggtc
gcccgccaccaagccaagctgtacggcaaggcctcggttggcgcgccgccgatgtcggta
ccgcacctggacacgcggatgatcgatggcaagcaggtgctgctgttcggcccgttcgcc
accttctccaccaagtacctcaagcacggctcgctgctggacatgttcgcctcgctgaac
agccacaacgtgctgccgatggtcaatgccggtatcgataacatcgacctcagcacctac
ctgatggggcagctgatgctcagtttcgatgaccgcatgaacgcgctgcgcgagtacttc
cccaacgccaagaacgaagactggaagttgctgcaggccggccagcgggtgcaggtgatc
aagaaggacccggtcctgggcggtgtgctgcagttcggtactgaagtggtggcggcgcag
gacggcagcatcgctgcgttgctgggagcttcgccgggtgcctcgacagcggcgccgatc
atgctgaccgtgctggaaaagaccttcaaggaccgtatccagtcgccagcctggcaggcc
aggctcaaggaaatcgtgccgagctatgggcaaaagctgaacaacaacctggcgctgacc
aaccagacccgggcatggagcagcgagcgcctgcagttgctgtatgtgccggtggaggcc
gaggtgtcgcactga

DBGET integrated database retrieval system