KEGG   Pseudomonas putida DLL-E4: DW66_4405Help
Entry
DW66_4405         CDS       T03439                                 

Definition
(GenBank) ketoglutarate semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00040  Pentose and glucuronate interconversions
ppud00053  Ascorbate and aldarate metabolism
ppud01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DW66_4405
   00053 Ascorbate and aldarate metabolism
    DW66_4405
Enzymes [BR:ppud01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     DW66_4405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHZ78906
UniProt: A0A059UW66
Position
4832489..4834066
Genome map
AA seq 525 aa AA seqDB search
MTLTGNLLIGQTPVTGSREAIRGIDPATGQTLEPAYLGGTGEHVAQACALAWAAFDAYRE
TSLEQRAQFLETIATQIEALGDALIDRAVAESGLPKARIQGERGRTCTQLRTFARVVRAG
EWLDVRVDNALPERQPLPRADLRQRQVALGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VVVKAHGAHPGTSELVGQAVAKAVKQCGLPAGVFSLLYGSGREVGIALVSDPRIKAVGFT
GSRSGGIALCQAAQARPEPIPVYAEMSSINPVFLFDTALQTRAEALAQGFVASLTQGAGQ
FCTNPGLVIARQGPALQRFIDAASEHVRQAAAQTMLTPGIFSAYQAGVGALAANANAQAA
ASGQAGQGPNQCQAQLFVTQAEAFLADPALQAEVFGAASLVVACANDEQVRQVAEHLEGQ
LTATLQLDDADIDNARILLPTLERKAGRILVNGWPTGVEVCDAMVHGGPFPATSDARTTS
VGTAAILRFLRPVCYQDFPDALLPQALKHGNPLQLRRLLDGKREG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcacaggcaacctgctgatcggccagacgccggtaaccggcagccgcgaagcc
atccgtggcatcgacccggccaccggccagacactggaaccggcctacctcggcggcacc
ggcgaacacgtggcccaggcctgcgccctggcctgggcggcgttcgatgcctaccgcgaa
acctcgctcgagcaacgggcacaattcctcgaaaccatcgccacgcagatcgaagcgctg
ggtgatgccctgatcgatcgcgccgtggccgaaagcggcctgccaaaggcgcgcatccag
ggcgaacgtggccgcacctgcacccagttgcgcaccttcgcacgtgtggtgcgggctggc
gaatggctggacgtgcgggtcgacaatgctctgcctgagcgccagcccctgccgcgtgcc
gacctgcgccagcgccaggtggccctggggccagtggcggtattcggcgccagcaatttc
ccattggccttctcggtggccggtggcgacaccgcctcggccctggccgccggttgcccg
gtggtggtcaaggcccacggcgcccacccgggcaccagcgagctggtcggccaggcagtg
gcaaaggccgtgaagcaatgcggcttgccggccggtgtgttttctctgttgtacggctcc
ggtcgtgaagtgggcattgcgctggtcagcgacccgcgcatcaaggccgttggctttacc
ggctcgcgcagcggtggcattgcgctgtgccaggcggcccaggcccgccccgagccgatc
ccggtgtacgccgaaatgagctcgatcaacccggtgttcctgttcgacaccgccctgcag
acccgcgccgaggcactggcacaaggcttcgtcgcctcgctgacccagggtgccggccag
ttctgcaccaaccccggcctggtgattgcccgtcaagggccggcgttgcagcgtttcatc
gacgccgccagcgaacacgtgcgccaggctgcggcgcagaccatgcttaccccaggcatt
ttcagtgcctaccaggccggtgtcggcgccctggccgcaaacgccaatgcccaggccgcc
gccagtggccaggccgggcaaggccccaaccagtgccaggcgcagctgttcgtgacccag
gccgaagcgttcctcgccgacccggcgttgcaggccgaagtcttcggcgcggcgtcgctg
gtggtggcctgcgccaacgatgagcaagtgcgccaggtggccgagcatctggaaggccaa
ctgaccgccaccctgcaactggacgatgccgacatcgacaacgcccgcattctgctgccg
acccttgagcgcaaggctggccgcatcctggtcaatggctggccgaccggtgtagaggta
tgcgacgcgatggtccacggcgggccgttcccggccacctccgatgcccgcaccacttcg
gtgggcacggcggcgatcctgcgcttcctgcgcccggtgtgctaccaggacttccccgat
gccctgctgccgcaggcactgaaacacggcaacccgctgcagcttcggcgcctgctcgac
ggtaaacgggaaggctga

DBGET integrated database retrieval system