KEGG   Pseudomonas putida DLL-E4: DW66_4835Help
Entry
DW66_4835         CDS       T03439                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00350  Tyrosine metabolism
ppud00643  Styrene degradation
ppud01100  Metabolic pathways
ppud01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DW66_4835
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    DW66_4835
Enzymes [BR:ppud01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     DW66_4835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: AHZ79334
UniProt: A0A059V593
Position
complement(5313371..5314003)
Genome map
AA seq 210 aa AA seqDB search
MELYTYYRSTSSYRVRIALALKGLGYQSLPVNLLQGEQRGAGYVAVNPQGRVPALRTDGG
ELLVQSPAIIEYLEEVYPQPALLPATAEARAKVRGVAAIIGCDIHPLHNVSVLNRLRQAG
QDESQVNQWIGHWISQGLGAVEQLIGDHGFCFGDEPGLADVYLIPQLYAAERFNVDLDSF
PRILRVAALAAEHAAFAQAHPARQPDSPAQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtacacctattaccgttccacctcgtcctaccgggtacgcattgctttggca
ctgaaggggctgggttaccagtcccttccggtcaacctgctgcagggcgaacagcgcggc
gcgggttatgtcgcggtcaacccgcaggggcgcgttccggcgttgcgtaccgatggcggt
gagctgctggtgcagtcgccggcgatcatcgagtacctggaagaggtttatccacaacct
gcgctgttaccggccacggccgaggcgcgtgccaaggtgcggggcgtggcggcgatcatc
ggctgcgatatccatccgctgcacaacgtcagcgtgctcaaccggctgcgccaggccggc
caggacgaaagccaggtcaaccaatggattggtcactggatcagccaagggttgggggca
gttgagcaactgataggcgatcatggcttctgcttcggcgatgagccgggcctggcggat
gtctatctgatcccgcagttgtacgcggccgaacgtttcaacgtcgacctcgacagcttc
ccgcgcatccttcgggttgccgcccttgcggccgagcacgcggcgttcgcccaggcccac
cccgcccggcagccggacagcccggctcagtga

DBGET integrated database retrieval system