KEGG   Pseudomonas putida DLL-E4: DW66_5441Help
Entry
DW66_5441         CDS       T03439                                 

Definition
(GenBank) glycine cleavage system aminomethyltransferase T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
ppud  Pseudomonas putida DLL-E4
Pathway
ppud00260  Glycine, serine and threonine metabolism
ppud00630  Glyoxylate and dicarboxylate metabolism
ppud00670  One carbon pool by folate
ppud01100  Metabolic pathways
ppud01110  Biosynthesis of secondary metabolites
ppud01130  Biosynthesis of antibiotics
ppud01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppud00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DW66_5441
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DW66_5441
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DW66_5441
Enzymes [BR:ppud01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     DW66_5441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: AHZ79937
UniProt: A0A059V3B9
Position
complement(5999582..6000664)
Genome map
AA seq 360 aa AA seqDB search
MGQRTLLYDLHLALGAKTVDFGGWDMPLHYGSQVEEHHQVRSDCGVFDVSHMTVIDVDGS
DATAWLQRLLANDVARLDDTGKALYSPLLQEQGRVIDDLIVYRTQHGYRLVTNAATRAKV
LDWLQQQRDGFAVDFQVRPDLAILAIQGPHAREKVAALLSPSRAALIRELRPFEGFAEGD
WFIARTGYTGEDGLEIILPGEQAVAFFNDLVGAGIAPSGLGARDTLRLEAGMNLYGQDID
ENHTPLTSNLGWSIAWEPAERDFIGRAGLLAEIEHGVQEKLVGLVLEERGVLRAHQVVRV
AGIGEGEITSGSFSPTLSKSIALARVPMATGDRAEVEIRSKWYPVRVVKPTFVRHGKILI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggacagcgcacgcttttgtatgacctgcacctggcgcttggcgccaagacggtcgat
ttcggtggctgggacatgcccctgcactatggctcgcaggtcgaggagcaccatcaggtg
cgcagcgattgcggggtgttcgatgtttcccacatgaccgtgatcgatgtcgatggtagc
gacgccaccgcctggttgcagcgtctgctggccaacgacgtggcccgcctcgacgacacc
ggcaaggcgctgtacagcccgctgttgcaggaacagggcagggtgatcgacgacctgatc
gtctaccgcacacaacatggctatcgcctggtcaccaacgccgccacccgtgccaaggta
ctcgactggctgcagcagcagcgtgacggttttgccgtggacttccaggtccgcccagac
ctggccatccttgccatccagggcccgcatgctcgagaaaaggttgcagccctgctcagc
ccctcgcgtgcggcgctgatccgcgaactgcgtcctttcgaaggctttgccgaaggcgac
tggttcattgcccgcaccggttataccggtgaagacggcctggagatcatcctccccggc
gagcaggccgtggccttcttcaacgacctggtcggtgccggcatcgcccccagcggcctt
ggtgcccgcgataccctgcgcctggaagccggcatgaacctgtacggccaggacatcgac
gaaaaccacacaccgctcacctccaacctcggctggagcatcgcctgggagccggccgag
cgcgacttcatcgggcgcgctgggctgctggcggaaatcgagcacggcgtgcaggaaaaa
ctggtcggcctggtgctggaagagcgtggcgtgctgcgtgcccaccaggtggtgcgtgta
gccgggattggcgaaggggagatcaccagtggtagtttctcgcctacgctgagcaagtcc
attgcccttgcacgcgtgcccatggccactggcgaccgggccgaggtggaaattcgcagc
aagtggtacccggtgcgggtggtcaaaccgaccttcgtgcgccacggcaagatcctgatc
tga

DBGET integrated database retrieval system