KEGG   Pseudomonas putida HB3267: B479_00635Help
Entry
B479_00635        CDS       T02389                                 

Gene name
glyQ
Definition
(GenBank) glycyl-tRNA ligase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B479_00635 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppuh01007]
    B479_00635 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ppuh03016]
    B479_00635 (glyQ)
Enzymes [BR:ppuh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     B479_00635 (glyQ)
Amino acid related enzymes [BR:ppuh01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   B479_00635 (glyQ)
Transfer RNA biogenesis [BR:ppuh03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    B479_00635 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AGA71045
UniProt: L0FDK7
Position
complement(144072..145019)
Genome map
AA seq 315 aa AA seqDB search
MSQPTPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTATFLRAVGPETWNAAY
VQPSRRPADGRYGENPNRLQHYYQFQVVLKPNPANFQELYLGSLKAIGLDPLVHDIRFVE
DNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTGEITYGLERLAMYIQGVD
SVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLFELFDFYESEANRLIKLEL
PLPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLARDVAQSYLQARARLGFPMAT
PELRDEVLAKLEAAQ
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagcctacgccagccgtgcgtaccttccaagacctgatcctcgccctgcagaac
tactgggccgagcaaggttgtgtggtgcttcagccctacgatatggaagtaggcgccggc
actttccacaccgctacattcctgcgcgccgtgggtccagaaacctggaacgccgcctat
gtgcagcctagccgtcgccctgccgacgggcggtatggcgaaaaccccaaccgcctgcag
cactactaccagttccaggtggtactgaagcccaacccggccaacttccaggagctgtac
ctcggctcgctgaaagccatcggcctggacccgctggtccacgacattcgcttcgtcgaa
gacaactgggaatcgccgaccctcggcgcctggggcctgggctgggaaatctggctcaac
ggcatggaagtcacccagttcacctacttccagcaggtaggcggcatcgagtgctaccca
gtcactggtgaaattacctacggcctggagcgcctggccatgtacatccagggcgtcgac
tcggtgtacgacctggtgtgggccgacggcccgttcggcaaggtcacctacggcgacgtg
ttccaccagaacgaggtggagcagtcgacctacaacttcgagcacgccaacgtcgacaag
ctgttcgagctgttcgacttctacgaaagcgaagccaaccgcctgatcaagcttgagctg
ccgctgccgacctatgaaatggtcctgaaggcctcgcacaccttcaacctgctggacgcc
cgccgcgccatctcggtaaccgagcgccagcgctacatcctgcgtgtacgtaccctggcc
cgggacgtggcgcaaagctatctgcaagcccgcgcacgcctgggcttcccgatggccacc
cctgaactgcgtgacgaagtgttggctaagctggaggctgcacaatga

DBGET integrated database retrieval system