KEGG   Pseudomonas putida HB3267: B479_09025Help
Entry
B479_09025        CDS       T02389                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00071  Fatty acid degradation
ppuh00072  Synthesis and degradation of ketone bodies
ppuh00280  Valine, leucine and isoleucine degradation
ppuh00310  Lysine degradation
ppuh00362  Benzoate degradation
ppuh00380  Tryptophan metabolism
ppuh00620  Pyruvate metabolism
ppuh00630  Glyoxylate and dicarboxylate metabolism
ppuh00640  Propanoate metabolism
ppuh00650  Butanoate metabolism
ppuh00900  Terpenoid backbone biosynthesis
ppuh01100  Metabolic pathways
ppuh01110  Biosynthesis of secondary metabolites
ppuh01120  Microbial metabolism in diverse environments
ppuh01130  Biosynthesis of antibiotics
ppuh01200  Carbon metabolism
ppuh01212  Fatty acid metabolism
ppuh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B479_09025
   00630 Glyoxylate and dicarboxylate metabolism
    B479_09025
   00640 Propanoate metabolism
    B479_09025
   00650 Butanoate metabolism
    B479_09025
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B479_09025
   00072 Synthesis and degradation of ketone bodies
    B479_09025
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B479_09025
   00310 Lysine degradation
    B479_09025
   00380 Tryptophan metabolism
    B479_09025
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B479_09025
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B479_09025
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B479_09025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppuh04147]
    B479_09025
Enzymes [BR:ppuh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B479_09025
Exosome [BR:ppuh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B479_09025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGA72711
UniProt: L0FJ10
Position
2008233..2009426
Genome map
AA seq 397 aa AA seqDB search
MTLANDPIVIVSAVRTPMGGLQGDLKSLTAPQLGSAAIRGAVERAGIDAASVEQVLFGCV
LPAGQGQAPARQAALGAGLDKHTTCTTLNKMCGSGMQAAIMAHDLLLAGTADVVVAGGME
SMTNAPYLLDKARGGYRMGHGRVIDHMFMDGLEDAYDKGRLMGTFAEDCAQANAFSREAQ
DQFAIASLTRAQDAIKSGRFAAEIVPVEVTEGKETRVIKDDEQPPKARLDKIPQLKPAFR
EGGTVTAANSSSISDGAAALVLMRRSEADKRGLKPLAVIHGHAAFADTPALFPTAPIGAI
DKLMKRTGWNLAEVDLFEINEAFAVVTLAAMKHLDLPHDKVNIHGGACALGHPIGASGAR
ILVTLLSALRQNNLRRGVAAICIGGGEATAMAVECLY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgccaatgacccgatcgttatcgtcagcgccgtgcgcacgcccatgggcggc
ctgcagggcgacctcaagagcctgaccgcgccgcagctgggcagcgccgccatccgtggt
gccgtggagcgtgccggcatcgatgctgccagtgtcgagcaggtgctgttcggctgcgtg
ctgccggctggccagggccaggcaccggcgcgccaggccgcgctgggcgccgggctggac
aagcacaccacctgcaccaccttgaacaagatgtgcggttcgggcatgcaggcggcgatc
atggcccatgacctgctgctggccggtaccgccgatgtggtggtggccggtggcatggaa
agcatgaccaatgcgccgtacctgctggacaaggcccgtggcggttaccgcatgggccac
ggcagggtcatcgaccacatgttcatggacggcctggaagacgcctacgacaagggccgc
ctgatgggcacctttgccgaagactgcgcccaggccaatgccttcagccgcgaagcccag
gaccagttcgccatcgcctcgctgacccgcgcccaggacgctatcaagagtggtcgcttt
gctgccgagatcgtgccggtcgaggttaccgagggcaaggagacgcgcgtcatcaaggac
gacgaacaaccgcccaaggcgcgcctggacaagatcccgcagctcaagccggccttccgc
gaaggcggcacggtgaccgccgccaactccagctcgatttccgacggcgctgcggcgctg
gtgctgatgcgccgctccgaagccgacaagcgcggcctcaagccgctggcggtgatccac
ggccacgccgcttttgccgacaccccggcactgttcccgaccgcgccgatcggtgccatc
gacaaactgatgaaacgcactggctggaacctggccgaggtcgacctgttcgagatcaac
gaggctttcgccgtggtcaccctggcggccatgaagcacctcgacctgccgcacgacaag
gtcaatatccatggcggcgcctgcgccctcggccacccgatcggcgcttccggcgcgcgc
atcctggtgaccctgctgtcggccctgcgccagaacaacctgcgccgtggcgtggcggcc
atctgcatcggcggtggcgaggccacagccatggctgtcgaatgcctgtactga

DBGET integrated database retrieval system