KEGG   Pseudomonas putida HB3267: B479_14095
Entry
B479_14095        CDS       T02389                                 

Definition
(GenBank) EvpB family type VI secretion protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    B479_14095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppuh02044]
    B479_14095
Secretion system [BR:ppuh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   B479_14095
SSDB
Motif
Pfam: VipB VipB_2 TssC
Other DBs
NCBI-ProteinID: AGA73713
UniProt: L0FL27
Position
3096249..3097751
AA seq 500 aa
MTDKQTAPQQAGDLVEVENFAPQASLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEG
EMTPSKDLIAVLDSRIAEIDSMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLK
IHLLNASKKDLVRDLKAASEFDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMY
LLEEISHVAAAAHAPFISAASPELFGWDSFTEMSGPRDLAKIFDTVEYAKWKSFRASEDS
RYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKYLWMNAAYALGTRVTDAFARY
GWCVAIRGVEGGGLVEGLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFIPLVHCK
GTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQ
LDELTASLRLVAELPQGARG
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgaccgacaagcaaaccgcaccgcaacaggccggcgacctggtcgaagtggaaaacttc
gcgccacaggcatcgttgctcgacagcatcatttcgcaaagccgcgtggcccgctccgac
accgagcgcaaccgcacccgcgacctgattggcgaactggtgaaccaggtgctcgagggc
gagatgaccccgagcaaggacctgatcgccgtgctcgattcgcgtatcgccgagatcgat
tcgatgctttccgagcagatgaacgaaatcatgcacgcccgtgagttccaacagctggaa
gcctcctggcgcggcctgaaataccaggtagaccagaccgagaccagcaccacgctgaag
atccacctgctcaatgcctcgaagaaagacctggtacgcgacctgaaggccgccagcgaa
ttcgaccagagcgcgctgttcaagaaggtctacgaagaagagtacggcaccttcggcggc
gcgcctttcggcatgctgatcggtgattacgagttcaaccgcaaccccgaagacatgtac
ctgctggaggagatctcgcacgtcgccgcagcagcccatgccccgttcatttcggccgcc
tcccccgagctgttcggctgggactcgttcaccgagatgtccggcccgcgtgacctggcg
aagatcttcgacaccgtggaatacgccaagtggaagtcgttccgcgcttcggaagactcg
cgctacgtcggccttaccctgccgcacgtgctcggtcgcctgccgtatggcccggacacc
accccggtggaggaattcaacttcgtcgaaagcgtcgatggccgcgaccacaacaagtac
ctgtggatgaacgctgcctatgccctcggcacccgcgttaccgatgccttcgcccgctac
ggctggtgcgtggccatccgcggcgtggaaggtggcggcctggtcgaaggtttgccaacc
cacaccttcaagaccgacgacggcgaaatcgccctcaagtgcccgaccgaaatcgccatc
accgaccgccgcgaaaaagagctgtcggacctgggcttcattcccctggtgcactgcaag
ggcaccgactatgccgcgttcttcggcacccagtcggcgcagaagcagaagcagtacaac
accgacatcgccaacgccaacgcgcgcctgtcggcccaactgcagtacatcttcgccact
tcgcgcatcgcccactacatgaaggccatcatgcgcgacaagatcggtagcttcgcctcg
cgcatggatgtggagcgcttcctcaaccagtggctggccagctacgtgctgctcgacgac
accgccagccaggaagccaaggccaagttcccgctgcgcgaagcccgcgccgaggtgttc
gaagtgccgggcaagccaggtgtgtacaaggccgtgacctacctgcgcccgcactaccag
ctggatgagctgaccgcttcgctgcgcctggttgccgagctgccacagggcgcgcgcggc
tga

DBGET integrated database retrieval system