KEGG   Pseudomonas putida HB3267: B479_14105
Entry
B479_14105        CDS       T02389                                 

Definition
(GenBank) type VI secretion protein
  KO
K11896  type VI secretion system protein ImpG
Organism
ppuh  Pseudomonas putida HB3267
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppuh02044]
    B479_14105
Secretion system [BR:ppuh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   B479_14105
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AGA73715
UniProt: L0FM23
Position
3098260..3100080
AA seq 606 aa
MLDELLPYYEKELSHLRFLGQEFAAQYPKIASRLLIEGDNCEDPHTERLIEAFSFLSARV
HKKLDDEFPEIVESFLEVLYPHYLRPTPSMSIAELSLGKHEKVTEAYRVARHTEMHANAV
EGVVCKFRTCYPVELWPIAVQQASFAELERSAFNGHSADLVARLRIRLAATGDALFGQME
LDRLRFFLDGEATLMLQLYELLFNNLAKATLSFQDQGRSREVALPADALKAVGYARDEGL
VDYSERSFLGYRLLHEYFTFPDKFMFFDLNGFARILQGKAIEQVEINFYFSDYDLSERLA
RLTQNIGRNNFKLNCTPIINLFRQQAEPIKLTHTQHEYPVTPDTRLHNAAEVVSIDRVRR
VRKLGGIDQVATCHPFFEPRGEQDPHSSFWVARRRIQGDATAMSIRVVDRDLELIDASSD
TLSIGLTCSNRDVPLMLPFGGERGDFNIPANSVIKDIRCLRKPTATVRVPLGKGLIWRLI
AHLSLNHMSLVSQGREVLLELLSLYNYRNVSAIRKQINGIKAISSEPVVARIGHPRPNFV
RGVGITLTLDESQFIGSGVYLFGMVLDHFFGQYCSMNSFTQLTLRTQQREKRVVQWPART
GDQPLV
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgctcgacgaactgctgccctactacgaaaaggaactgtcgcacctgcgcttcctcggc
caggagtttgccgcgcagtacccgaaaatcgcttcgcggctgttgatcgagggtgacaac
tgcgaagacccgcacaccgagcgcctgatcgaagcgttctcgttcctgtctgcgcgggtg
cacaagaagctcgatgacgagtttccggaaatcgtcgaatccttccttgaggtgctgtac
ccacactacctgcgccctaccccatcgatgtcgattgccgagctgagcctgggcaagcac
gagaaagtcaccgaagcctaccgggtggcgcgccataccgagatgcatgccaatgccgtg
gaaggtgtggtgtgcaagttccgcacctgctacccggtagagctgtggccgattgccgtg
cagcaggcctcgttcgccgaactggagcgttcggccttcaacggccacagcgccgacctg
gtcgcacgcctgcgcatccgcctggcagccaccggcgatgccctgttcgggcagatggaa
ctggaccgcctgcggttcttcctcgacggcgaggcgaccctgatgctgcagctgtacgag
ctgctgttcaacaacctggccaaggccaccctgagcttccaggaccagggccgcagccgc
gaagtggccttgccggccgatgccctgaaagccgtgggctacgcccgtgacgaaggcctg
gtggactactccgagcgctcgttcctgggctaccgcctgctgcacgagtacttcaccttc
cccgacaagttcatgttcttcgacctgaacggctttgcccgcattcttcagggcaaggcc
atcgagcaggtcgagatcaacttctatttttccgactacgacctcagcgagcgcctggcg
cggctgacccagaacatcgggcgcaacaacttcaagctcaactgcacaccgatcatcaac
ctgttccgccagcaagccgagccgatcaagctgacccacacccagcacgaatacccggtc
actcccgatacacggctgcacaacgctgccgaagtcgtctcgatcgaccgcgtacggcgg
gtgcgcaaactcggcggcatcgaccaggtcgccacctgccacccgtttttcgaaccccgt
ggcgagcaggacccgcacagcagcttctgggtggcgcgccggcgcatccagggtgacgcc
accgccatgagcatccgcgtggtcgaccgcgacctggagctgatcgacgccagcagcgac
accctcagcatcggccttacctgcagcaaccgcgatgtaccgctgatgctgccgttcggg
ggcgaacgtggtgacttcaacattcccgccaactcggtgatcaaggatatccgctgcctg
cgcaagcccaccgccacggtgcgtgtgcccctgggcaagggcctgatctggcggttgatc
gcccacctgtcgctgaaccatatgtcgctggtcagccagggccgcgaagtgctgctggag
ctgttgtcgctgtacaactaccgcaatgtttccgccattcgcaaacagatcaacggcatc
aaggcgatcagcagcgagccggtggtcgcacgcatcggccacccgcggccgaacttcgta
cgtggcgtcggcatcacgctgaccctggatgaaagccagttcatcggcagtggcgtgtac
ctgttcggcatggtgctggaccacttcttcggccagtactgctcgatgaacagcttcacc
caactgaccctgcgcacccaacaacgagaaaagagagtcgtccaatggccagcacgcacc
ggcgatcagcccctggtctga

DBGET integrated database retrieval system