KEGG   Pseudomonas putida HB3267: B479_14110
Entry
B479_14110        CDS       T02389                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    B479_14110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppuh02044]
    B479_14110
Secretion system [BR:ppuh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   B479_14110
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AGA73716
UniProt: L0FLU6
Position
3100044..3101114
AA seq 356 aa
MASTHRRSAPGLIDQARAEPHRFEFFQLVRLLRLHYSRTGRMDLATRPHEDPLRFRTQLS
LAFPASEVSDLHFEREGKVSPAGLPLSEVQVTFMGLVGPSGVLPRPYTELLLERHVQYRD
DAAHAFLDIFSHRMTTLFYEAWQKYKFHIEHERNGTSGFDGYLLNLVGLGPRAQQLKFEQ
QPTALRRELFSYFAGLLSQKPRNALNLERMLGFYFSLPIKVRQFAGRWLHLQPEQCTQLG
RRNAQLGHSAVAGNRVWDYQSCIRIELGPLSLADYQRFQPGTACYRKLVELVRFYIGAEL
DFEIAPRLKREAVPRAQLGRSGNVALGWLGWLKRPGRDAEPSRCAVFHIPYDGVAL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggccagcacgcaccggcgatcagcccctggtctgatcgatcaggcccgagccgagccg
caccgattcgaattctttcaattggtgcgcctgctccgcctgcactacagccgtaccggg
cgcatggacctggcaacccggccgcacgaagacccgctgcgttttcgtacccagctttcg
ctggcgttcccggccagcgaggtcagcgacctgcacttcgagcgcgaaggcaaggtgtcg
ccggccggcttgccgctgtcggaagtgcaggtcaccttcatgggcctggtcgggccgtcg
ggcgtactgccgcgcccgtataccgagctgctgctggagcgccacgtgcagtatcgcgac
gatgccgcccacgcgtttctcgacatcttctcgcaccgcatgaccacgctgttctacgag
gcctggcagaagtacaaatttcatatcgagcacgagcgcaatggcacttcgggcttcgat
ggctacctgctcaacctggtcggcctcggcccgcgcgcgcagcaactcaagttcgagcag
caaccaaccgcgctgcgccgcgagctgttcagctactttgccggcctgctcagccagaag
ccgcgcaacgcgttgaacctcgaacgcatgctcggcttctatttctcgctgccgatcaag
gtccgccagttcgccgggcgctggctgcacctgcagcccgaacaatgcacccagcttggc
cgccgcaatgcccagctcggccacagcgccgtagccggcaaccgggtctgggactaccag
tcgtgcatccgcatcgagctggggccgctgagcctggccgattaccagcgcttccagccg
ggcaccgcgtgctaccgcaagctggtcgagctggtgcgcttctatataggcgccgaactg
gatttcgaaattgccccgcgcctcaagcgcgaggcggtgccacgcgcccagctgggccgc
agtggcaatgtcgccctgggctggctgggctggctcaaacgccctggtcgtgacgcggag
ccttcgcgttgcgccgtcttccacattccttacgatggggtcgccttgtga

DBGET integrated database retrieval system