KEGG   Pseudomonas putida HB3267: B479_14130
Entry
B479_14130        CDS       T02389                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    B479_14130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppuh02044]
    B479_14130
Secretion system [BR:ppuh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   B479_14130
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AGA73720
UniProt: L0FM28
Position
3105792..3106508
AA seq 238 aa
MTEAVLQQGAVAAANDKPTLKDLVQDFISMALIVRRGRQVTSVPAFEASVERFFANLERE
ARAANYSAEQVKDTQYALCAFLDESVLRASDNQLRQHFELQPLQFRYFGVHLAGEGFFEK
VDALRADVKQNIDVLEVYHLCLALGFEGKFSLGQKDQLRYLANTLGQDIARYRKAPKALS
PDWALPDQVSQMLRHEVPLWVYLALIALVCVAVYLTLDWLLDKDVAALSEQIRQLFSA
NT seq 717 nt   +upstreamnt  +downstreamnt
atgaccgaagccgtattgcaacagggcgccgtcgcggccgccaacgacaaaccgacgctc
aaggacctggtccaggacttcatcagcatggccctgatcgtgcggcgtggtcgtcaggtc
acctcggtgccggccttcgaagccagcgtggaacgcttcttcgccaacctggaacgcgaa
gcacgcgctgccaactacagcgccgaacaggtcaaggacacccagtacgcgctgtgtgcc
ttcctcgacgagagcgtgctgcgcgcgagcgacaaccagctgcgccagcacttcgagctg
cagccgctgcagttccgctacttcggcgtgcacctggcgggtgaaggcttcttcgagaag
gtcgatgcgctgcgtgccgacgtcaagcagaacatcgatgtgctcgaggtctaccacctg
tgcctggccttgggcttcgagggcaagttcagcctcggccagaaagaccagctgcgctac
ctggccaataccctgggccaggatattgcccgctaccgcaaggcgcccaaagcactgtca
ccggactgggcactgcccgaccaggtgtcgcagatgctgcgccacgaggtgccgctgtgg
gtttacctggcgctgatcgcgctggtctgcgtcgccgtgtacctgacgctggactggttg
ctggacaaggacgtcgccgccctttccgaacaaatccgccagctgttcagtgcctga

DBGET integrated database retrieval system