KEGG   Pseudomonas putida HB3267: B479_14135Help
Entry
B479_14135        CDS       T02389                                 

Definition
(GenBank) ImcF domain-containing protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh02025  Biofilm formation - Pseudomonas aeruginosa
ppuh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    B479_14135
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    B479_14135
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppuh02044]
    B479_14135
Secretion system [BR:ppuh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   B479_14135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C MMR_HSR1 CAP59_mtransfer AAA_16
Motif
Other DBs
NCBI-ProteinID: AGA73721
UniProt: L0FLU9
Position
3106539..3110342
Genome map
AA seq 1267 aa AA seqDB search
MKTLLRLLKNFWFLLLLLWLASLLTCWLVAPLLPWLQQHLPEALAIISACFLLVIVLRQY
QRIRAEHNLENLLQIEVDRSWNATGEFRDQQVLRERLKHAIAMLRTDRSAGGGGKAALSD
LPWYLVVGMSAAGKTSLLTHSGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRD
DQSASEFSAFLRMLRKQRGKAAINGLVMVVSLPELLAANSDERNALAAQLVARVEEYAEC
LDANPPVYLMLSKTDQLPGFSQAFDGLDLHERQQPLGMTFGLSEIRNNGLHAVLQTRLGN
LQNHIRQHVDAQVIALGAEADSTLLNFPQYFAALSGVLEQFLEHFTRGHRGGAPLLLRGL
YFTSALQTGQQLGQVYEDVIADEFALQAAYDEHTENVGKAAGNRSYFITDTFRQVIFPDR
DLTLYQSRLGRQAAFSPLLLGLAAATGLLFIGWQALSFTNNRQWLDSLRVQLAQIEQAED
REQQLAAGKGLEVLREQMARVENHRLQGVPLQLGGGLYHGEAIHQVTRTAYLAQLRSQAL
EPIARSLQVQMRAFNTFANGINQELEFTPAPTPKKRNGKPLAPAIAAKAQAALGNSRAGA
YAAKVNLATASDAAELSATTGGLSLSEEMLGRLDEQQVASIIDAYNTLKLYLLLTEPQGH
PDPAFVAANLPQAWASAATEGTPADAAVIAENAPLYVQLLEQGQAPSLPRNEQLINETRQ
NLKSFMISSSLVDREYLRLQLESSRQFPALSLNDLVPQPGRALLYGSAGVPAIYTRQGWD
TFVKPELIKLVSGNLRNESDWVLDGEGGDAIVQKANFVREFMTRYKRDYTQAWYKMVSSV
GVRHFADLASATQQLGLLSDVQNSPVKNLLAAVNDNTQWDLPVKHAIPAPGSTREDGFWS
KVSGLLDTKDALPANVAPALPAVDDGSLAKRFEPVARVFAENNAEGADSTIMDRYLAALR
KLKVRMNNIQRSQDVGKSSKQLISETLEGQPSEVTNVRNYVESSVDTSQDGLSRSLQGLF
SLPIQYAWATLRDPAGQQIAKAWAQQIAKPWEQVMAHRYPIAGSSRNEASVKDLQRFVDP
DSGLLPAFKRNEIGNLAGGEGLGVGDGKAPALVNPGMLNSIDKASSVGQVIASLSDRDNG
FEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWNRFAWPGTSNAPGARLDVVTLSGARVTV
FDFPGRWGLLRMNESARVEDLDGIQQRFSWNTASGRVSLVVRNFGGVKLTDLGDVKALSA
LNDRGAQ
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattactgcgccttttgaagaatttctggtttctcctgctgctgctgtggctg
gcgagcctgttgacctgctggttggtcgccccgttgctgccatggctgcaacagcacctg
cccgaagcactggcaatcatcagcgcctgcttcctgctggtgatcgtgctgcgccaatac
cagcgcattcgcgccgagcacaacctggagaacctgctgcagatcgaggttgatcgctcg
tggaatgccactggcgagttccgtgaccagcaggtgctgcgcgaacgcctcaagcatgcc
attgccatgttgcgcaccgaccgctccgctggaggcggtggcaaggcggcactgtccgac
ttgccctggtacctggtggttggcatgtcggcagccggcaagacctcgctgctgacccat
tccggcctgtcggccagcattgccacggccaacgacagcgaaagcggcacccagcactgc
gactggtacttcagccccgacgcggtaatgatcgacaccgccggccgctatttgcgtgat
gaccagtcggccagcgagttctcggccttcctgcgcatgctgcgcaagcagcgcggcaag
gcggcgatcaatggcctggtaatggtggtcagcctgcccgagctgctggcagccaacagc
gacgaacgcaatgccctggcggcccagctggtggcgcgggtggaagaatacgccgagtgc
ctcgacgccaacccgccggtgtacctgatgctgagcaagaccgaccagttgccgggcttc
agccaggcgttcgacggccttgacctgcatgaacgccagcaaccgctgggcatgaccttc
ggcctgtcggaaatccgcaacaacggcctgcacgccgtgctgcagacgcgcctgggcaac
ctgcagaaccacattcgccagcatgtcgacgcacaggtgatcgccctcggtgccgaagcc
gacagcaccctgctgaacttcccgcaatacttcgccgcactcagcggtgtcctcgagcag
ttcctggagcacttcacccgcggccatcgcggcggtgccccgctgctgctgcgcggcctg
tacttcaccagcgccctgcagaccgggcagcagctggggcaggtatacgaagacgtcatc
gccgacgaattcgccctgcaagccgcctacgatgagcacaccgagaacgtcggcaaggcc
gcgggcaaccgcagctacttcatcaccgacaccttccgccaggtgatcttccccgatcgc
gacctgaccctgtaccagtcgcgcctgggccgccaggctgcgttcagcccgctgctgctg
ggcctggccgccgccaccgggttgctgttcatcggttggcaggcactgtcgttcaccaat
aaccgccaatggctggacagcctgcgcgtgcagctggcgcagatcgagcaggcagaagac
cgcgagcagcagctggccgctggcaagggcctggaagtgctgcgcgaacagatggcccgc
gtcgaaaaccatcgcctgcagggtgtaccactgcagttggggggtggcctgtaccatggc
gaagccatccaccaggtgactcgcaccgcctacctggcgcaactgcgcagccaggcgctg
gagccgatcgcacgcagcctgcaagtgcagatgcgggccttcaacaccttcgccaacggt
atcaaccaggagctggaattcaccccggccccgacaccgaaaaaacgcaatggcaagccg
ctggccccggccattgcagccaaggcccaggctgcgctgggcaacagccgcgccggtgcc
tatgccgccaaggtcaacctggccaccgccagcgatgccgccgagctgtctgccaccacc
ggtggcctgtcactgtccgaagaaatgctcgggcgcctcgacgaacagcaggtggcctcg
atcatcgatgcctacaacaccctcaagctgtacctgttgctgaccgagccccaaggccat
ccggacccggccttcgtcgctgccaacctgccccaggcctgggccagcgccgccaccgaa
ggcactccggccgacgcagccgtgatcgcagaaaatgccccgctttacgtacagttgctg
gaacaaggccaggcgccgtcgttgccgcgtaacgaacagctgatcaacgaaacccggcaa
aacctcaagtcgttcatgatctccagctcgctggtcgatcgcgagtacctgcgcctgcaa
ctcgagtcgagccgccagttcccggccctgagccttaacgacctggtgccgcaaccgggc
cgcgcgttgctgtatggctctgctggcgtaccggcaatctatacccgccagggctgggac
accttcgtcaagccggaactgatcaagctggtgtcgggcaacctgcgcaacgagtcggac
tgggtgctggacggtgaaggcggcgatgccatcgtgcagaaggccaacttcgtgcgcgag
ttcatgacccgctacaagcgcgactacacccaggcctggtacaagatggtcagcagcgtg
ggggtacgccacttcgccgacctggcctcggccacccagcagctggggctgctcagcgat
gtgcagaactcgccggtaaagaacctgctggcggcggtcaatgacaacacccagtgggac
ctgccggtcaagcacgccatcccggcccccggtagtacccgcgaagacggcttctggagc
aaggtctccggcctgctcgacaccaaggacgccctgcccgccaacgtcgccccggccctg
ccggcggtggacgacggcagcctggccaagcgcttcgaaccggtggcgcgggtatttgcc
gaaaacaacgccgaaggcgccgacagcaccatcatggaccgctacctggccgccttgcgc
aagctcaaggtgcgcatgaacaacatccagcgttcgcaggatgtgggcaagagcagcaag
cagctgatcagcgagaccctagaaggccagccgagcgaagtcaccaacgtgcgcaactat
gtggaaagcagcgtcgacaccagccaggacggcctgtcgcgctcgctgcaggggctgttc
agcctgcctatccagtatgcctgggcgaccctgcgcgacccggccggccagcagatcgcc
aaggcctgggcgcagcagatcgccaagccttgggaacaggtcatggcgcaccgctacccg
attgccggcagcagccgcaacgaggcgtcggtaaaggacctgcagcgcttcgtcgacccc
gacagcggcctgctgccggccttcaagcgcaacgaaatcggcaacctggccgggggtgaa
ggcctgggtgtgggcgacggcaaggcaccggcgctggtcaacccaggcatgctcaacagc
atcgacaaggccagctccgtgggccaggtgatcgccagcctgtcggaccgtgacaacggc
ttcgaaatcatgctggaaccttctgccaacttcaccgacatcgtgttcaccctcgatggc
caggaacagcactaccgcaacggccgcagtagctggaaccgcttcgcctggccgggcacc
agcaacgctccgggtgcccgcctggatgtggtcaccctcagtggcgcgcgggtcaccgtg
ttcgacttccccgggcgctggggcctgctgcgcatgaacgaaagcgcccgggtcgaagac
ctggacggcattcagcaacgcttcagctggaacaccgccagcggccgcgtgagccttgta
gtgcgcaacttcggtggggtgaaactgaccgacctgggtgatgtcaaggcgctgagcgcc
ctcaacgacaggggcgcccaatga

DBGET integrated database retrieval system