KEGG   Pseudomonas putida HB3267: B479_14145
Entry
B479_14145        CDS       T02389                                 

Definition
(GenBank) OmpA/MotB domain-containing protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh02025  Biofilm formation - Pseudomonas aeruginosa
ppuh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    B479_14145
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    B479_14145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppuh02044]
    B479_14145
Secretion system [BR:ppuh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   B479_14145
SSDB
Motif
Pfam: IcmF-related_N IcmF-related OmpA MMR_HSR1 DUF1232
Other DBs
NCBI-ProteinID: AGA73723
UniProt: L0FL34
Position
3111244..3113739
AA seq 831 aa
MNKIKYYCLRYQPYLLGVAFFLAIFLVWAIGCALGFASLHSLLAGIGVFLLLSAGYVLLL
YRGAGQHHNLEGLLRDDADQAVLNATPADREEVSLLRERLLQSIERLRSNTPRGTSAKDA
LYALPWYLVIGQPAAGKSTMILQSGLNFPYAEREGARVAGLGGTRNCDWFFSSEAVLLDT
AGRYMNSPEEAGKWRGFLQLLRQHRQRRPLNGLIVSVSIADILHGSAEDQDRVAKRLRER
IQESCALLEVRLPIYLVFTKCDLIPGFTPFYRQLDDAARGEVMGKTFSHKGYAQADWGQR
FGKAMDELTGYWQQVASQHLVQQDIQVTRQNNAAYRFPLELAALKPRLQQFVDSLLRANP
YQNAEMLRGFYFTAALQADEALWGSHGQHVAERFALEHAEGTATAVSQPAPLFINSLFRK
VIIPDQHLVALYTSNTRERRRKAGWVAATGLAALVLCSLWGWSYLNNRATLASIAGELAQ
AKADDQAARGQYAAWHSLDRLRFWAEHYYQQHREQGVPLGMRLGLYQGHEVEPLLRSRYF
ATLQNVMLKPTADNLTRTLYLLTTIKVYQRNTRELQPVSGVDSVEAEALPHDNRAQSIAD
FGKAALDTYVMLSPARRENADPAFLKAHLPDYWYPAIARHTGKSMAAAASEAGGNQDYLY
ASRQITFYSDQIREPDVPRILDNAFLMSSSRNYIDSLRAQSLRSIETITLESDTLFAFGR
ADFQSLKSEGQRQLSAIASKLLNTPDIGKIIISGHADQLGDSQGNLQVSKQRAQTIRTYL
VGKGVPAELVVAQGEGSRKPLVNCDLQQPRAQLIKCLEPNRRVEIEVRGLN
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgaacaagatcaagtactactgcctgcgctaccaaccctacctgctgggagtggcgttc
ttcctggcgatcttcctggtctgggccatcggctgcgccctgggcttcgcctcgctgcat
agcctgctggccggtatcggcgtgtttctgctgctgtcggcgggctatgtactgctgctg
taccgcggcgccggccagcaccacaacctcgaagggttgctgcgcgacgatgccgaccag
gcggtactcaacgccacccccgccgaccgcgaagaagtaagcctgctgcgcgaacgcctg
ctgcagagcatcgagcgcctgcgcagcaacacacctcgcggcacctcggccaaggacgcg
ctgtacgccctgccctggtacctggtgatcggtcagccggccgccggcaagagcacgatg
atcctgcagtcgggcctgaacttcccctatgccgaacgcgaaggcgcacgggttgcgggg
cttggcggcacgcgcaactgcgactggttcttcagctccgaagccgtgctgctggatacc
gccgggcgctacatgaacagccccgaagaagccggcaagtggcgcggcttcctgcagctg
ttgcgccagcatcgccaacgccgccctctcaacggcttgatcgtcagcgtcagcatcgcc
gacatcctgcatggctcggccgaggaccaggaccgcgtggccaagcgcctgcgtgaacgg
atccaggaaagctgcgcgctgctggaagtgcgcctgccgatctacctggtgttcaccaag
tgcgacctgatccccggcttcaccccgttctatcgccagcttgacgacgccgcgcgtggc
gaggtgatgggcaagaccttctcgcacaagggttacgcgcaggccgactggggccagcgc
ttcggcaaggcgatggacgaactgaccggttactggcagcaggtggcgagccagcacctg
gtgcagcaggacattcaggtcacccggcagaacaacgctgcctaccgcttcccgctggag
ctggccgcgctcaagccgcgcctgcagcagttcgtcgacagcctgttgcgtgccaacccg
taccagaatgccgaaatgctgcgcgggttctatttcactgccgcactgcaggccgacgaa
gccctgtggggcagccacggccagcatgtggccgaacgcttcgccctcgaacatgccgaa
ggcaccgccactgccgtcagccagccggcgccgctgttcatcaacagcctgttccgcaag
gtgatcatccctgaccagcacctggtggcgctgtacaccagcaacacgcgggagcgccgg
cgcaaggcgggctgggttgccgccaccggcctggcagccctggtgctgtgcagcctgtgg
ggctggtcgtacctgaacaaccgcgccaccctggccagcatcgccggcgaactggcccag
gccaaggccgacgaccaagctgcccgcggccagtacgccgcctggcatagccttgaccgc
ttgcgcttctgggccgagcactactatcagcagcaccgcgaacagggcgtgccgctgggc
atgcgcctgggcctgtaccagggccatgaggtcgagccgctgctgcgcagccgttacttc
gccacgctgcagaacgtgatgctcaagcccacggcagacaacctgacccgcaccctgtac
ctgctgaccacgatcaaggtgtaccagcgcaacacccgcgaactgcagcctgtgagcggc
gtggacagcgtcgaggccgaggcgctgccacatgacaaccgcgcgcagtcgatcgccgac
ttcggcaaggcagcgctggatacctacgtgatgctctcgccggcccgacgcgaaaacgcc
gacccggcgtttctcaaggcgcacctgcccgactactggtacccggccatcgctcgccat
accggcaagagcatggccgcggccgccagcgaggccggcggcaaccaggactacctgtac
gccagccgccagatcaccttctacagcgaccagattcgtgagccggatgtgccgcgtatc
ctcgacaacgccttcctgatgtccagttcgcgcaattacatcgacagcctgcgcgcccag
tcgctgcgttcgatcgagaccatcacgctggagtccgacaccctgttcgctttcggccgg
gccgacttccagagcctgaagagcgagggccagcgccagctgagcgcgatcgccagcaaa
ctgctgaacacgcccgacatcggcaagatcatcatttccggccacgccgaccagctcggc
gacagccaaggcaacctgcaggtttcgaaacagcgggcgcagaccattcgcacctacctg
gtcggcaagggcgtacctgccgaactggtggtcgcccagggcgaaggcagccgcaagccg
ctggtcaactgcgacctgcagcaaccgcgggcgcaactgatcaagtgcctggagcccaac
cgccgggtggaaatcgaagtacgcgggctcaactga

DBGET integrated database retrieval system