KEGG   Pseudomonas putida HB3267: B479_14150
Entry
B479_14150        CDS       T02389                                 

Definition
(GenBank) Hcp1 family type VI secretion system effector
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh02025  Biofilm formation - Pseudomonas aeruginosa
ppuh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    B479_14150
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    B479_14150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppuh02044]
    B479_14150
Secretion system [BR:ppuh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   B479_14150
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AGA73724
UniProt: L0FID7
Position
3113883..3114401
AA seq 172 aa
MAFDAYIQIDGIPGEVLDAKHKDWIEVLGYEYGATQATSATASSSGGASSERVALSDFKI
RKAVDKASAKLFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVRFIAGGNQN
GEDKAVSDLPVEEISFNFARIKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcatttgacgcgtatatccaaatcgacggcatcccgggcgaagtactggatgcaaag
cacaaggactggatcgaagtgctgggctacgagtacggcgccacccaggccacctcggct
accgccagctcctcgggcggtgcgtcgtccgagcgtgttgccctgagcgacttcaagatc
cgcaaggcggtcgacaaggcttcggccaagctgttcgaacactgctgcaccggcaagcac
atcgccaagctgaagctgaacgtgaaccgcgccggtggtgacaaggtcacctacctgacc
atcgacatggaagaagtcgtggtctcctcggtgcgcttcatcgccggtggcaaccagaac
ggtgaagacaaggctgtgagcgacctgccggtcgaagaaatcagcttcaacttcgcccgc
atcaaaactacctacacccagcagaaccgcaccgacggccaggctggcggcaacatcgtc
ggcggctgggaccgcaccgcgaacaaagtgtttgcctga

DBGET integrated database retrieval system