KEGG   Pseudomonas putida HB3267: B479_14155
Entry
B479_14155        CDS       T02389                                 

Definition
(GenBank) ImpA family type VI secretion-associated protein
  KO
K11902  type VI secretion system protein ImpA
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    B479_14155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ppuh02044]
    B479_14155
Secretion system [BR:ppuh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   B479_14155
SSDB
Motif
Pfam: ImpA_N ATP-grasp_5 DUF2514
Other DBs
NCBI-ProteinID: AGA73725
UniProt: L0FM32
Position
3114497..3115594
AA seq 365 aa
MPEILNDLSLATLTAPIEGGSGEDLSFSALFDQIKEARRADPDYLTQGDWQTDLKTADWE
QVVNLSAQGLAQQSKDLMLVAWLSEGLAQREHFEGITFGLRLTEQVLEAFWDTLYPTLED
GLDERAARLSWLKTTLTDIAGGLPITQGQNFGVLRYDESRYVENLALQNPKAMETALNEG
KINAEIFQRSVALSDTEHLRTKALQIAASLEACKALQASADRLFGHEAPSFASLADMLSR
ASQLAEKLLKDRGVELHPATVAAAEPEATVAPTSEAGEPMNTPVQATTPAPMRTTPLTRD
EAFTMLAGIAQFFKQSEPQSPVPYLIERAIKWGNMPLEGWLSDVIKDSNVVDNIRDVLGT
REPRS
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgcctgaaatcctcaatgacctttcgctggcaacgctgaccgcacccatcgagggtggc
agtggcgaagacttgagcttctctgccttgttcgaccagatcaaggaggcgcgccgggca
gaccctgactacctgacccagggcgactggcaaaccgacctgaagaccgccgactgggag
caggtggtcaacctgtcggcccaagggctggcgcagcaaagcaaggacctgatgctggta
gcctggctcagcgaagggttggcccagcgtgaacatttcgaaggcatcacctttggcctt
cggctgaccgaacaggtactggaagcattctgggacacgctgtacccaacactcgaagat
ggcctggacgaacgcgctgcgcggctgtcctggctgaagaccacgctcaccgacattgcc
ggtggcttgcccattacccaagggcagaattttggcgtgttgcgctatgacgaatcacgc
tacgtagaaaaccttgccttgcagaaccccaaggcaatggagaccgcgctgaacgaaggc
aagatcaacgccgaaatcttccagcgctcggtggcgctcagcgacaccgaacacctgcgc
accaaggccctgcagatcgccgccagcctggaggcctgcaaagccctgcaagccagtgcc
gaccgcctgttcggccatgaggcgcccagctttgccagccttgccgacatgctgtcgcgc
gccagccagctggctgaaaaactgctcaaggaccgcggtgtcgaactgcaccccgccact
gtggcagcggcagaacccgaagccactgttgcccccaccagcgaagcaggtgaaccgatg
aacacacccgtccaggccaccacgcctgcgccgatgcgcacgacgcccctgacccgcgac
gaagccttcaccatgcttgcgggtatcgcccagttcttcaagcagagcgaaccgcagagc
ccggtgccttacctgatcgaacgcgccatcaagtggggcaacatgccgctggaaggctgg
ctgagcgatgtgatcaaggacagcaacgtggtggacaacattcgcgacgtgctgggcacc
cgcgagccaagatcctga

DBGET integrated database retrieval system