KEGG   Pseudomonas putida HB3267: B479_14925Help
Entry
B479_14925        CDS       T02389                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00310  Lysine degradation
ppuh01100  Metabolic pathways
ppuh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    B479_14925
Enzymes [BR:ppuh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     B479_14925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Mqo NAD_binding_8 FAD_binding_3 Pyr_redox_2 Thi4 Trp_halogenase MCRA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGA73879
UniProt: L0FIT6
Position
complement(3301018..3302280)
Genome map
AA seq 420 aa AA seqDB search
MYDFIIIGGGIVGMSTAMHLIKVYPDAKILLLEKESGPARHQTGHNSGVIHAGVYYTPGS
LKARFCLEGNKATKAFCTQHGIRFDECGKLLVATNDLEMQRMKALWERTAANGLERYWLS
AAELREREPNIVGMGGIFVPSSGIVNYAEVTAAMGAEFQRAGGEIRYGAEVVGLQELASE
VVVRTRGDHHDDELRSRFLVTCSGLMADRVVSMLGLRTEFVICPFRGEYYLLPKQHNQIV
NHLIYPIPDPSMPFLGVHLTRMIDGTVTVGPNAVLAMKREGYRKRDVSPADLFQTLTTPG
ILKVLAKNFRPGLIEMKNSLFKGGYLKQVQKYCPSITKADLTPYPAGVRAQAVSRDGKLI
DDFLFVNTARSVNVCNAPSPAATSAIPIGAYIVDKVCEQVGRQGGSFPKADLAPRQRAAG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgatttcatcatcattggcggtggcattgtgggcatgtccacggccatgcacctg
atcaaggtctacccggatgcgaagattctcctgctggagaaagagtccggcccggcccgc
caccagaccggccacaacagcggcgtgatccacgccggcgtgtattacacccccggcagc
ctcaaggcgcgcttctgcctggaaggcaacaaggccaccaaggctttctgcacccagcac
ggtatccgcttcgatgaatgcggcaagctgctggtggctaccaacgacctggaaatgcag
cgcatgaaggcgctgtgggagcgcaccgcggccaatggcctggagcgctactggctgtcg
gcggccgaactgcgcgagcgcgagcccaatatcgttggcatgggcggcatcttcgtgccc
tccagcggtatcgtcaattacgctgaagtgactgcggccatgggcgccgagttccagcgc
gccggcggtgagatccgctatggcgccgaggtggttggcctgcaggagctggccagcgaa
gtggtcgtgcgcacgcgtggcgaccatcatgacgatgagttgcgcagccgtttcctggtg
acctgctcgggcctgatggccgaccgcgtggtgagcatgctgggcctgcggaccgagttc
gtcatctgcccgttccgtggcgagtactacctgctgcccaagcagcacaaccagatcgtc
aaccacctgatctacccgattcccgacccgtccatgccgttcctgggggtgcacctgact
cgcatgatcgacggcaccgtgaccgttggccccaacgccgtgctggcaatgaagcgcgag
ggttaccgcaagcgtgatgtcagcccagccgacctgttccagaccctgaccacccccggc
atcctcaaggtgctggcgaagaacttccgcccaggcctgatcgagatgaagaactcgctg
ttcaagggtggctacctcaagcaggtccagaaatactgcccgagcatcaccaaggccgac
ctcacgccttatccggccggcgtgcgtgcccaggccgtatcgcgtgacggcaagctgatc
gacgacttcctgttcgtcaacaccgctcgcagcgtcaacgtgtgcaacgcaccgtcgccg
gccgctacctccgccatcccgatcggcgcctacatcgtcgacaaggtatgcgagcaggtt
ggccgccagggcggcagtttccccaaggccgacctggcgcctcgtcagcgggctgccggc
tga

DBGET integrated database retrieval system