KEGG   Pseudomonas putida HB3267: B479_17435Help
Entry
B479_17435        CDS       T02389                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ppuh  Pseudomonas putida HB3267
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    B479_17435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGA74379
UniProt: L0FK81
Position
3829878..3831494
Genome map
AA seq 538 aa AA seqDB search
MATPSLASLPQLAERDARPQLAHKPGRATLVLFFGLLLAGIAYTAWSLKQDVTASGTVIT
TVTPFLLLGLALLIALGFEFVNGFHDTANAVATVIYTHSLPAPVAVVWSGLCNFLGVLLS
SGAVAFGIIALLPVELILQVGSSAGFAMVFALLLAAIIWNLGTWWLGLPASSSHTLIGSI
IGVGVANALMHGRDGTSGVDWAQASKVGYALLFSPLLGFACAALLLLALRALVKRKALYQ
APEGQRPPPWWIRGVLILTCTGVSFAHGSNDGQKGMGLIMLILVGTLPMAYALNKTMPNE
QALQFSAVAEVTRQALVRGAPQAAPADPRQVLTTFIAEPRANPQLIPALAALTGMIGEEV
KGYGSLKRVPAEAMANVRNDMYLTSEAIRLIEKNQLVVFDAGTRSQVLLFKTQLDDATRY
IPLWVKVAVAIALGLGTMVGWRRIVVTVGEKIGKTHLSYAQGASAEVVAMCTIGAADMFG
LPVSTTHVLSSGVAGTMVANGSGIQKRTLVNLLMAWVLTLPAAMLLAGSLYWLLHHIF
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccccttcactggccagtctgccgcaactggccgaacgcgatgcccgcccgcaa
cttgcccacaagcccgggcgtgccaccctggtgttgttcttcggcctgttgctggccggc
attgcctacaccgcctggagccttaaacaggatgtgacggccagcggcacggtaatcacc
acagtcacaccattcctgctgctgggcctggcgttgctgattgccctgggcttcgagttc
gtcaatggcttccatgacaccgccaacgcagtggccaccgtcatctacacccactcgttg
cctgcccccgtcgccgtggtctggtccgggctgtgcaacttcctcggcgtgctgctttcc
agtggcgcggtggcgttcggcatcatcgccctgctgccggtggagctgattctgcaggtc
ggctcctcggccggtttcgccatggtcttcgccctgctgctggcagcgatcatctggaac
ctcggcacctggtggctgggcctgccggcctcatcctcgcacaccctgatcggttcgatc
atcggcgtgggcgtggccaatgccctgatgcatgggcgcgacggcaccagtggcgtggac
tgggcccaggccagcaaggtcggttatgccctgctgttctcgccactgctcggctttgcc
tgtgccgccctcttgctgctggcactgcgcgcgctggtcaagcgcaaagcgctgtaccag
gcgccggaaggccagagaccgccaccgtggtggatccgcggcgtactgatcctgacctgc
accggggtgtcctttgctcacggctccaacgacggccagaaaggcatgggcctgatcatg
ctgatcctggttggcaccctgccgatggcttacgcattgaacaagaccatgcccaatgaa
caggccctgcagttttccgcggtcgccgaggtaacccgccaggcactggtgcgcggcgcc
ccgcaagcagcaccggccgacccacgccaggtgctgaccacgttcattgccgagcccagg
gccaacccgcaactgataccggcgctggcggcgctgaccggcatgatcggcgaagaggtc
aaaggttatggctcgctcaagcgggtaccggccgaagccatggccaacgtgcgcaacgac
atgtacctgaccagcgaagccatccgcctgatcgagaagaaccagctggtggtattcgat
gcaggtacacgcagccaggtgctgctgttcaagacccagctggatgatgccacccgctac
atcccgctgtgggtgaaagtggccgtggccatcgcactggggctgggcaccatggtcggc
tggcggcgcatcgtggtgacggtaggcgagaagatcggcaagacccacctcagctatgcc
cagggggcttcggccgaagtggtggcaatgtgtaccattggtgcggcggacatgttcggg
ttgccggtgtcgactacccatgtgctgagttccggggtggccgggaccatggtggccaac
gggtcggggattcagaagcgcacgctggtcaacctgctgatggcctgggtgctgaccttg
ccggcagcaatgctgttggccggcagcctgtactggctgctgcaccacattttctga

DBGET integrated database retrieval system