KEGG   Pandoraea pulmonicola: RO07_10510Help
Entry
RO07_10510        CDS       T03553                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppul  Pandoraea pulmonicola
Pathway
ppul00071  Fatty acid degradation
ppul00072  Synthesis and degradation of ketone bodies
ppul00280  Valine, leucine and isoleucine degradation
ppul00310  Lysine degradation
ppul00362  Benzoate degradation
ppul00380  Tryptophan metabolism
ppul00620  Pyruvate metabolism
ppul00630  Glyoxylate and dicarboxylate metabolism
ppul00640  Propanoate metabolism
ppul00650  Butanoate metabolism
ppul00900  Terpenoid backbone biosynthesis
ppul01100  Metabolic pathways
ppul01110  Biosynthesis of secondary metabolites
ppul01120  Microbial metabolism in diverse environments
ppul01130  Biosynthesis of antibiotics
ppul01200  Carbon metabolism
ppul01212  Fatty acid metabolism
ppul02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RO07_10510
   00630 Glyoxylate and dicarboxylate metabolism
    RO07_10510
   00640 Propanoate metabolism
    RO07_10510
   00650 Butanoate metabolism
    RO07_10510
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RO07_10510
   00072 Synthesis and degradation of ketone bodies
    RO07_10510
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RO07_10510
   00310 Lysine degradation
    RO07_10510
   00380 Tryptophan metabolism
    RO07_10510
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RO07_10510
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RO07_10510
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RO07_10510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppul04147]
    RO07_10510
Enzymes [BR:ppul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RO07_10510
Exosome [BR:ppul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RO07_10510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJC20800
UniProt: A0A0A8BSY1
Position
complement(472521..473705)
Genome map
AA seq 394 aa AA seqDB search
MQQDPIVIVSAARTPMGGLQGVFGEVAAPQLGAAAIRAAVERAGLKPEQVDEVVMGCVLP
AGQGQAPARQAALGAGLPLGAGATTVNKMCGSGMRAAMFAHDMLAAGSADVIVAGGMESM
SNAPYLLPKARAGMRMGHGQVIDHMFLDGLEDAYDKGRLMGTFAEECADRYAFTREAQDA
FAIASLERAQNAAKDGSFDWEITAVTVPGRKGDTVVGQDEQPFKANPEKIPTLKAAFRKD
GTVTAANSSSISDGAAALVLMRESTAKRLGLAPLARIAGHSTFAQQPGLFTTAPVGAMRK
LFEKTGWSSNDVDLYEINEAFAVVTMAAMHEFNLPHEKVNIHGGACALGHPIGASGARIL
VTLIGALRKTGGKRGVASLCIGGGEATAMAIELV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagacccgatcgttatcgtttccgccgcgcgcacgccgatgggcggcctgcag
ggagtgttcggcgaggtcgccgcgccgcaactgggcgcggccgccattcgcgccgccgtc
gagcgtgccggcctcaagccggaacaggtcgatgaagtcgtgatgggctgcgtgctgccc
gccggccagggacaggcccccgcgcgtcaggccgcgctcggcgcggggctgccgctcggc
gctggcgccaccaccgtgaacaagatgtgcggctcgggcatgcgcgccgccatgttcgcg
cacgacatgctcgccgccggcagcgccgacgtgatcgtcgccggcggcatggaaagcatg
agcaacgcgccctacctgctgcccaaggcccgcgccggcatgcgcatgggccacggccag
gtcatcgaccatatgttcctcgacgggctggaagacgcctacgacaagggccgcctgatg
ggcaccttcgccgaagagtgcgccgaccgctacgccttcacgcgcgaagcacaggacgcc
ttcgccatcgcctcgctcgagcgtgcgcaaaacgccgcgaaagacggttcgttcgactgg
gaaatcaccgccgtgacggtgccgggccgcaagggcgataccgtggtcgggcaggacgaa
caaccgttcaaggccaaccccgagaagattccaacgctcaaggccgccttccgcaaggac
ggcacggtcaccgccgccaattcgtcgtcgatttccgacggcgccgccgcgctcgtgctc
atgcgcgaatcgaccgccaaacgcctgggcctcgcgccactcgcacgcatcgccggccac
agcacgttcgcgcagcagccggggctgttcacgaccgccccggtcggcgccatgcgcaag
ctgttcgagaaaaccggctggtcgtcgaacgacgtcgacctctatgaaatcaacgaagcc
ttcgccgtcgtcacgatggcagcgatgcacgaattcaatctgccgcacgagaaggtgaac
atccacggcggcgcctgcgcgctcggtcacccgatcggcgcctcgggcgcgcgcatcctg
gtcacgctcatcggtgcgctgcgcaagaccggcggcaagcgcggcgtggcgagtctctgc
atcggcggcggcgaggccaccgcgatggccatcgaactcgtctga

DBGET integrated database retrieval system