KEGG   Pandoraea pulmonicola: RO07_15330Help
Entry
RO07_15330        CDS       T03553                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ppul  Pandoraea pulmonicola
Pathway
ppul00450  Selenocompound metabolism
ppul00970  Aminoacyl-tRNA biosynthesis
ppul01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppul00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RO07_15330
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RO07_15330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppul01007]
    RO07_15330
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ppul03016]
    RO07_15330
Enzymes [BR:ppul01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RO07_15330
Amino acid related enzymes [BR:ppul01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RO07_15330
Transfer RNA biogenesis [BR:ppul03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RO07_15330
 Prokaryotic type
   Other AARSs
    RO07_15330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Ribosomal_60s Zn_Tnp_IS1595
Motif
Other DBs
NCBI-ProteinID: AJC21517
UniProt: A0A378Z278
Position
complement(1533483..1535591)
Genome map
AA seq 702 aa AA seqDB search
MSRRILVTSALPYANGQIHIGHLVEYIQTDIWVRHMRMQGHEVYYVGADDTHGTPVMLRA
EKEGLTPKQLIERVWKEHKRDFDSFGISFDNYYSTDSEENRELSESVYLALKEQGLIEAR
DIEQAYDPVKEMFLPDRFIKGECPKCGAKDQYGDSCEVCGSTYAPTDLINPYSVVSGATP
VRKTSTHYFFKLSDKRCEQFLRKWVAGLAQPEAANKMKEWLGEDGESTLADWDISRDAPY
FGFEIPGAPGKYFYVWLDAPVGYYASFRNLCAKRGLNFEEWVKPGSSTEQYHFIGKDILY
FHTLFWPAMLEFSGHRTPTNVYAHGFLTVDGQKMSKSRGTFITAQSFIDTGLNPEWLRYY
IGAKLGNTMEDIDLNLDDFIARVNSDLVGKYVNIASRAAGFLIKRFDGRVSAHAMQHELL
TQLRGVAAQIAAHYEAREFGKALRLVMEQADAVNGYVDTVKPWDLAKDPAQAAALHEACS
VCLEAFRLLTLYLKPVLPVTAEAVERFLSIAPQTWQDVERPLTADTAITAYKHLMTRVEG
KQVEALLAANRDSLQAAAPTAAADAADKGKAAKGTKETAKAEKTAEGDGFITIDDFAKID
LRIARIVDCKAVEGSDKLLQLTLDVGEAQTRNVFSGIKSAYPQPEALVGKLTVMVANLAP
RKMKFGLSEGMVLAASAADEKAEPGIYILEPHNGAKPGMRVK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgccgcattctcgtcacctccgccctgccgtacgccaatggccagattcacatc
ggtcacctggtcgagtacatccagaccgacatctgggtgcggcacatgcgaatgcagggg
catgaggtgtactacgtcggcgcggacgacacgcatggcacgcccgtcatgctgcgcgcc
gaaaaggaagggctcacgcccaagcagttgatcgagcgtgtctggaaggaacacaagcgc
gacttcgacagcttcggcatctcgttcgacaactactattcgaccgattccgaagaaaac
cgcgaattgtccgaaagcgtctatctcgcgctcaaggaacagggcctcatcgaggcgcgc
gatatcgaacaggcgtatgacccggtcaaggaaatgttcctgccggaccgcttcatcaag
ggcgagtgcccgaagtgcggcgcgaaggaccagtacggcgactcatgcgaggtgtgcggt
tcgacctacgcgccgaccgacctgatcaacccgtactcggtcgtctcgggcgccacgccg
gtgcgcaagacgtccacgcactacttcttcaagctctcggacaaacgttgcgagcagttc
ctgcgcaagtgggtggctggcctcgcgcagcccgaagcggccaacaagatgaaggaatgg
ctcggcgaagacggcgagtcgacgctggccgactgggacatctcgcgcgatgcgccctac
ttcggcttcgagattcccggcgcccccggcaagtacttctacgtctggctggacgccccg
gtcgggtactacgcgagcttcaggaacctgtgcgcgaagcgcgggctgaacttcgaggag
tgggtgaaaccgggttcgagcaccgagcagtaccacttcatcggcaaggacatcctgtac
ttccacacgctgttctggcccgcgatgctcgaattctcgggccatcgcacgccgaccaac
gtgtacgcccacggcttcctcaccgtggacggccagaagatgtcgaagtcgcgcggcacg
ttcatcacggcgcagagcttcatcgacaccggcctgaacccggaatggctgcgctactac
atcggcgcgaagctcggcaacacgatggaagacatcgacctgaacctcgatgacttcatt
gcacgcgtgaacagcgatctggtcggcaagtacgtcaacatcgcgagccgcgcggcgggc
ttcctgatcaagcgtttcgacggtcgcgtgtcggcgcacgccatgcagcatgagctgctg
acgcagctgcgcggtgtggccgcgcagatcgccgcgcactacgaggcacgcgaattcggc
aaggcgctgcgtctcgtgatggaacaggccgatgcggtcaacggctacgtcgacacggtc
aagccgtgggatctggccaaggatccggcgcaggcggccgcgctgcacgaggcatgctcg
gtgtgtctggaggccttccgcctgctcacgctgtatctcaagccggtcctgccggtgacc
gccgaggcggtggagcgcttcctgagcatcgccccgcaaacgtggcaggacgtggagcgc
ccgctcaccgccgacaccgcgatcaccgcgtacaagcacctgatgacgcgcgtcgagggc
aagcaggtcgaggcgttgctcgccgccaaccgcgactcgctgcaagcggccgccccgacg
gcggcagccgacgcggcggacaagggcaaggcagcgaaggggacgaaggaaaccgcaaag
gcggaaaagacggccgagggcgacggcttcatcaccatcgacgacttcgcgaagatcgat
ctgcgcattgcgcgcatcgtcgattgcaaggcggtggaaggctccgacaagcttctgcaa
ctgacgctcgacgtgggcgaagcgcaaacgcgcaacgtcttctccggcatcaagtcggcg
tatccgcagccggaggcgctcgtgggcaagctcacggtgatggtagccaacctcgcgccg
cgcaagatgaagttcggcctgtccgaaggcatggtgctcgccgcctcggccgccgacgag
aaggccgagcccggcatctacatcctcgagccgcacaacggcgcgaagcctggtatgcgt
gtgaagtaa

DBGET integrated database retrieval system