KEGG   Pandoraea pulmonicola: RO07_16830Help
Entry
RO07_16830        CDS       T03553                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
ppul  Pandoraea pulmonicola
Pathway
ppul00740  Riboflavin metabolism
ppul00790  Folate biosynthesis
ppul01100  Metabolic pathways
ppul01110  Biosynthesis of secondary metabolites
ppul02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ppul00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    RO07_16830
   00790 Folate biosynthesis
    RO07_16830
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RO07_16830
Enzymes [BR:ppul01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     RO07_16830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AJC23415
UniProt: A0A378Z1G0
Position
1944348..1944995
Genome map
AA seq 215 aa AA seqDB search
MKSPGTASTTPACDAGECVELVASATLPTRYGTFTSHAFRVKGGDNEHLALVMGDVAGDT
PTLVRLHSECLTGDVFGSYRCDCGEQLDAGMRKIAEAGRGVMLYLRGHEGRGIGLSNKIR
AYLLQEQGRDTVEANLDLGLPDDAREYDSAAAILRILGVRSVRLMSNNPKKFDTLAKHGI
PVCERVALDIPMREENERYIRTKQVKFGHYFEENE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcccctggtactgcctccaccacgcccgcgtgcgacgccggcgagtgcgtcgag
cttgtcgcatcggcgacgctgccgacccgctatggcaccttcacctcccacgcatttcgc
gtcaagggcggcgataacgaacatctggcgctggtcatgggcgatgtcgccggcgacacg
cccacgcttgtgcgcctgcattccgagtgtctgacaggggacgtcttcggctcgtatcgc
tgcgattgcggcgaacagctcgacgccggcatgcgcaagattgccgaggccggacgcggc
gtgatgctctatctgcgcggccacgaagggcgcggcatcggcctgagcaacaagattcgg
gcatatctgctgcaggagcaggggcgcgacaccgtcgaggcgaacctggacctgggcttg
ccggacgacgcgcgggaatacgattccgccgctgccatcctgcgcattctcggcgtgcgc
tcggtgcgcctgatgagcaacaatccgaagaagttcgacacccttgccaagcacggcatc
ccggtgtgcgagcgcgtcgccctcgacattccgatgcgcgaagaaaacgaacgctacatc
cgcaccaagcaggtcaagttcggccactacttcgaagagaacgaataa

DBGET integrated database retrieval system