KEGG   Pandoraea pulmonicola: RO07_19680Help
Entry
RO07_19680        CDS       T03553                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ppul  Pandoraea pulmonicola
Pathway
ppul00620  Pyruvate metabolism
ppul00630  Glyoxylate and dicarboxylate metabolism
ppul01100  Metabolic pathways
ppul01110  Biosynthesis of secondary metabolites
ppul01120  Microbial metabolism in diverse environments
ppul01200  Carbon metabolism
Module
ppul_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RO07_19680
   00630 Glyoxylate and dicarboxylate metabolism
    RO07_19680
Enzymes [BR:ppul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RO07_19680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AJC22151
UniProt: A0A378Z0E3
Position
2561782..2563380
Genome map
AA seq 532 aa AA seqDB search
MPLMLPPGMQLHVDVNTDIRPEYEAILTPEALAFITRLHRAFEPRRQELLAARAARVARL
DAGEVPDFLPETQPIRDGDWRIAPLPAALQCRRVEITGPVERKMIINALNSGADSYMTDF
EDSNTPNWHNQLQGHINVRDAVRGVISLEQNGKHYKLNDKVATLIVRPRGWHLDEKHVSV
DGVRMSGSLFDFGLHFFHNAKASLARGFGPYYYLPKLESHLEARLWNDVFVLAQNELGVA
QGTIKATVLVETILAAFEMDEILYELREHSSGLNAGRWDYIFSCIKKFKVDADFCLADRS
RINMTVPFMRAYALLLLKTCHRRGAPAIGGMSALIPIKNDPEANEKAMAGIRGDKARDAT
DGYDGGWVAHPGLVPVAMEEFVKVLGDRPNQIDRQRDDVNVKGRDLLEFKPEAPITEAGL
RNNINVGIHYLGAWLAGNGCVPIHHLMEDAATAEISRSQVWQWIRSPKGKLDDGRKVTAE
LVRELIPQELANVKELVGQVAPTYDRAAVIFEQMSTSEDFVDFLTLPLYEEV
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgatgctgccccccggcatgcaattgcatgtcgacgtcaataccgatattcgt
cccgagtacgaagcgatcctgacgcccgaggcgctcgccttcatcaccaggctgcaccgc
gcattcgagccgcgtcgccaggaactgctcgccgcccgcgcggcgcgcgtcgcccgcctg
gatgccggcgaagtgcccgacttcctccccgagacgcaaccgattcgcgatggcgactgg
cgcattgcgccgctgccggcggcactgcaatgccgccgcgtggagattaccgggccggtc
gagcgcaagatgatcatcaacgcgctcaattcgggggcggacagctatatgaccgacttc
gaggactcgaacacgccgaactggcacaaccagttgcagggccacatcaatgtgcgcgac
gccgtgcgcggcgtcatcagcctcgagcagaacggcaagcactacaaattgaacgacaag
gtggccacgctgatcgtgcgtccgcgcggctggcatctcgacgagaagcatgtgagcgtg
gacggcgtgcgcatgtcgggcagcctgttcgatttcggcctgcatttcttccacaacgcc
aaggcgtcgctggcgcgcggcttcggtccgtactactacctgccgaagctcgagagccat
ctcgaggcgcgtctgtggaacgacgtcttcgtgctcgcccagaacgagctcggcgtggcg
caaggcacgatcaaggcgaccgtgctcgtcgaaacgattctcgccgccttcgagatggac
gagatcctgtacgagctgcgcgagcacagctcggggctgaacgccgggcgctgggactac
atcttttcgtgcatcaagaagttcaaggtcgacgcggacttctgcctggccgatcgcagc
cgcatcaacatgacggtgccgttcatgcgcgcttacgcgttgctgctgctcaagacgtgc
catcgtcgcggtgcgccggccattggcggcatgagcgcgctcattcccatcaagaacgat
ccggaagcgaacgagaaggcgatggccggcattcgcggcgacaaggcacgcgatgcgacc
gacggctatgacggcggttgggtcgcgcacccgggcctcgtgccggtggcgatggaagaa
ttcgtgaaagtgctcggcgatcgtccgaaccagatcgacaggcaacgcgacgacgtgaac
gtcaagggccgcgatctgctggagttcaagcccgaagccccgatcacggaggccggcctg
cgcaacaacatcaacgtcggtattcactatttgggcgcctggctcgccggcaacggttgc
gtgcccatccatcatctgatggaggacgccgcgacggcggagatttcgcgctcgcaggtg
tggcagtggattcgctcgcccaagggcaagctcgacgacggccgcaaagtcaccgccgaa
ctcgtgcgcgaactgattccgcaggagctcgcgaacgtcaaggaactcgtggggcaggtc
gcgccgacgtacgatcgcgccgcggtcatcttcgagcagatgagcacgagcgaggacttc
gtggatttcctcacgctgccgctgtacgaagaagtgtga

DBGET integrated database retrieval system